Microcebus murinus (gray mouse lemur): 105869954 Help Entry 105869954         CDS       T07238                                  Symbol IL4 Name (RefSeq) interleukin-4   KO K05430   interleukin 4 Organism mmur  Microcebus murinus (gray mouse lemur) Pathway mmur04060   Cytokine-cytokine receptor interaction mmur04151   PI3K-Akt signaling pathway mmur04630   JAK-STAT signaling pathway mmur04640   Hematopoietic cell lineage mmur04657   IL-17 signaling pathway mmur04658   Th1 and Th2 cell differentiation mmur04659   Th17 cell differentiation mmur04660   T cell receptor signaling pathway mmur04664   Fc epsilon RI signaling pathway mmur04672   Intestinal immune network for IgA production mmur05140   Leishmaniasis mmur05200   Pathways in cancer mmur05310   Asthma mmur05320   Autoimmune thyroid disease mmur05321   Inflammatory bowel disease mmur05330   Allograft rejection Brite KEGG Orthology (KO) [BR:mmur00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     105869954 (IL4)    04151 PI3K-Akt signaling pathway     105869954 (IL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105869954 (IL4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     105869954 (IL4)    04660 T cell receptor signaling pathway     105869954 (IL4)    04658 Th1 and Th2 cell differentiation     105869954 (IL4)    04659 Th17 cell differentiation     105869954 (IL4)    04657 IL-17 signaling pathway     105869954 (IL4)    04664 Fc epsilon RI signaling pathway     105869954 (IL4)    04672 Intestinal immune network for IgA production     105869954 (IL4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105869954 (IL4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     105869954 (IL4)   09163 Immune disease    05310 Asthma     105869954 (IL4)    05320 Autoimmune thyroid disease     105869954 (IL4)    05321 Inflammatory bowel disease     105869954 (IL4)    05330 Allograft rejection     105869954 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mmur04052]     105869954 (IL4)    00536 Glycosaminoglycan binding proteins [BR:mmur00536]     105869954 (IL4) Cytokines and neuropeptides [BR:mmur04052]  Cytokines   Interleukins    105869954 (IL4) Glycosaminoglycan binding proteins [BR:mmur00536]  Heparan sulfate / Heparin   Cytokines    105869954 (IL4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL4 Motif Other DBs NCBI-GeneID:  105869954 NCBI-ProteinID:  XP_012617583 Ensembl:  ENSMICG00000012471 UniProt:  A0A8B7G5R4 LinkDB All DBs Position 19:26462691..26471016 Genome browser AA seq 153 aa AA seqDB search MGLTSQMIPPLFCLLACAGSMAHGHRCGVILTESIKTLNILTESKTPCTELAVADVFAAP KNTTEKEIFCRAATVLRQLYSHRENAICRGAATPPRFHSHQHVIKLLKGLDRNLCSMAHA SRCPVSEAKQSTLRDFLERLKAIMKEKYSKCQS NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgggtctcacctcccagatgatccctcctctgttctgcctcctagcatgtgccggcagc atggcccacggacacagatgcggcgtcatcttaacagagagcatcaaaactctgaacatc ctcacagagagcaagactccgtgcaccgagctggctgtagcagacgtctttgctgccccc aagaacaccactgagaaggaaatcttctgcagggcggcgaccgtgctccggcagctctac agtcaccgcgagaacgccatctgcaggggcgcggccacaccgccacggttccacagccac cagcacgtgatcaaactcctgaaaggactggacaggaacctctgcagcatggcacacgcg agccgctgccctgtgagtgaagccaagcagagcacgctgagagacttcttggaaaggcta aaggcgatcatgaaggagaaatattcaaagtgtcagagctga

DBGET integrated database retrieval system