Microcebus murinus (gray mouse lemur): 105876728 Help Entry 105876728         CDS       T07238                                  Symbol BCL2 Name (RefSeq) apoptosis regulator Bcl-2   KO K02161   apoptosis regulator Bcl-2 Organism mmur  Microcebus murinus (gray mouse lemur) Pathway mmur01521   EGFR tyrosine kinase inhibitor resistance mmur01522   Endocrine resistance mmur01524   Platinum drug resistance mmur04064   NF-kappa B signaling pathway mmur04066   HIF-1 signaling pathway mmur04071   Sphingolipid signaling pathway mmur04115   p53 signaling pathway mmur04140   Autophagy - animal mmur04141   Protein processing in endoplasmic reticulum mmur04151   PI3K-Akt signaling pathway mmur04210   Apoptosis mmur04215   Apoptosis - multiple species mmur04217   Necroptosis mmur04261   Adrenergic signaling in cardiomyocytes mmur04340   Hedgehog signaling pathway mmur04510   Focal adhesion mmur04621   NOD-like receptor signaling pathway mmur04630   JAK-STAT signaling pathway mmur04722   Neurotrophin signaling pathway mmur04725   Cholinergic synapse mmur04915   Estrogen signaling pathway mmur04928   Parathyroid hormone synthesis, secretion and action mmur04933   AGE-RAGE signaling pathway in diabetic complications mmur05014   Amyotrophic lateral sclerosis mmur05022   Pathways of neurodegeneration - multiple diseases mmur05132   Salmonella infection mmur05145   Toxoplasmosis mmur05152   Tuberculosis mmur05161   Hepatitis B mmur05162   Measles mmur05168   Herpes simplex virus 1 infection mmur05169   Epstein-Barr virus infection mmur05170   Human immunodeficiency virus 1 infection mmur05200   Pathways in cancer mmur05206   MicroRNAs in cancer mmur05207   Chemical carcinogenesis - receptor activation mmur05210   Colorectal cancer mmur05215   Prostate cancer mmur05222   Small cell lung cancer mmur05226   Gastric cancer mmur05417   Lipid and atherosclerosis mmur05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mmur00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     105876728 (BCL2)  09130 Environmental Information Processing   09132 Signal transduction    04340 Hedgehog signaling pathway     105876728 (BCL2)    04630 JAK-STAT signaling pathway     105876728 (BCL2)    04064 NF-kappa B signaling pathway     105876728 (BCL2)    04066 HIF-1 signaling pathway     105876728 (BCL2)    04071 Sphingolipid signaling pathway     105876728 (BCL2)    04151 PI3K-Akt signaling pathway     105876728 (BCL2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105876728 (BCL2)   09143 Cell growth and death    04210 Apoptosis     105876728 (BCL2)    04215 Apoptosis - multiple species     105876728 (BCL2)    04217 Necroptosis     105876728 (BCL2)    04115 p53 signaling pathway     105876728 (BCL2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     105876728 (BCL2)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     105876728 (BCL2)   09152 Endocrine system    04915 Estrogen signaling pathway     105876728 (BCL2)    04928 Parathyroid hormone synthesis, secretion and action     105876728 (BCL2)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     105876728 (BCL2)   09156 Nervous system    04725 Cholinergic synapse     105876728 (BCL2)    04722 Neurotrophin signaling pathway     105876728 (BCL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105876728 (BCL2)    05206 MicroRNAs in cancer     105876728 (BCL2)    05207 Chemical carcinogenesis - receptor activation     105876728 (BCL2)   09162 Cancer: specific types    05210 Colorectal cancer     105876728 (BCL2)    05226 Gastric cancer     105876728 (BCL2)    05215 Prostate cancer     105876728 (BCL2)    05222 Small cell lung cancer     105876728 (BCL2)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     105876728 (BCL2)    05161 Hepatitis B     105876728 (BCL2)    05162 Measles     105876728 (BCL2)    05168 Herpes simplex virus 1 infection     105876728 (BCL2)    05169 Epstein-Barr virus infection     105876728 (BCL2)   09171 Infectious disease: bacterial    05132 Salmonella infection     105876728 (BCL2)    05152 Tuberculosis     105876728 (BCL2)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     105876728 (BCL2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     105876728 (BCL2)    05022 Pathways of neurodegeneration - multiple diseases     105876728 (BCL2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105876728 (BCL2)    05418 Fluid shear stress and atherosclerosis     105876728 (BCL2)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     105876728 (BCL2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     105876728 (BCL2)    01524 Platinum drug resistance     105876728 (BCL2)    01522 Endocrine resistance     105876728 (BCL2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mmur01009]     105876728 (BCL2) Protein phosphatases and associated proteins [BR:mmur01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      105876728 (BCL2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 ARMH5 Motif Other DBs NCBI-GeneID:  105876728 NCBI-ProteinID:  XP_012629923 Ensembl:  ENSMICG00000036161 UniProt:  A0A8B7H1C6 LinkDB All DBs Position 19:21873384..22072482 Genome browser AA seq 236 aa AA seqDB search MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGEASAAPPGAVPAPGIFSSQPGGTPPPA APRDPAARTSPPAAHAAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTP FTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNR HLHTWIQDNGGWDAFVELYGPNMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK NT seq 711 nt NT seq  +upstreamnt  +downstreamnt atggcgcacgctgggagaacagggtatgataaccgggagatagtgatgaagtacatccac tataagctgtcgcagaggggctacgagtgggatgctggagaagcgagcgctgcgcccccg ggggccgtccccgcacctggcatcttctcttcccagcccgggggcaccccccctcccgct gcgcctcgggacccggccgccaggacctcgcccccggccgcccacgccgctgccgcgggg cctgcgctcagcccagtgccacctgtggtccacctgaccctccgccaggcgggcgatgac ttctcccgccgctaccgccgcgacttcgccgagatgtccagccagctgcacctgacgccc ttcaccgcgaggggacgctttgccacggtggtggaggagctcttcagggatggggtgaac tgggggaggattgtggccttctttgagttcggtggggtcatgtgtgtggagagcgtcaac cgggagatgtcgcccctggtggacaacatcgccctgtggatgactgagtacctgaaccgg cacctgcacacctggatccaggataacggaggctgggacgccttcgtggaattgtatggc cccaacatgcggcctctgtttgatttctcctggctgtctctgaagactctgctcagcctg gccctggtgggagcttgcatcaccctgggtgcctatctgggccacaaatga

DBGET integrated database retrieval system