Microcebus murinus (gray mouse lemur): 105880942 Help Entry 105880942         CDS       T07238                                  Symbol IFNG Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism mmur  Microcebus murinus (gray mouse lemur) Pathway mmur03050   Proteasome mmur04060   Cytokine-cytokine receptor interaction mmur04066   HIF-1 signaling pathway mmur04217   Necroptosis mmur04350   TGF-beta signaling pathway mmur04380   Osteoclast differentiation mmur04612   Antigen processing and presentation mmur04630   JAK-STAT signaling pathway mmur04650   Natural killer cell mediated cytotoxicity mmur04657   IL-17 signaling pathway mmur04658   Th1 and Th2 cell differentiation mmur04659   Th17 cell differentiation mmur04660   T cell receptor signaling pathway mmur04940   Type I diabetes mellitus mmur05140   Leishmaniasis mmur05142   Chagas disease mmur05143   African trypanosomiasis mmur05144   Malaria mmur05145   Toxoplasmosis mmur05146   Amoebiasis mmur05152   Tuberculosis mmur05160   Hepatitis C mmur05164   Influenza A mmur05168   Herpes simplex virus 1 infection mmur05200   Pathways in cancer mmur05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mmur05321   Inflammatory bowel disease mmur05322   Systemic lupus erythematosus mmur05323   Rheumatoid arthritis mmur05330   Allograft rejection mmur05332   Graft-versus-host disease mmur05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mmur00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     105880942 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     105880942 (IFNG)    04630 JAK-STAT signaling pathway     105880942 (IFNG)    04066 HIF-1 signaling pathway     105880942 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105880942 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     105880942 (IFNG)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     105880942 (IFNG)    04612 Antigen processing and presentation     105880942 (IFNG)    04660 T cell receptor signaling pathway     105880942 (IFNG)    04658 Th1 and Th2 cell differentiation     105880942 (IFNG)    04659 Th17 cell differentiation     105880942 (IFNG)    04657 IL-17 signaling pathway     105880942 (IFNG)   09158 Development and regeneration    04380 Osteoclast differentiation     105880942 (IFNG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105880942 (IFNG)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     105880942 (IFNG)   09172 Infectious disease: viral    05160 Hepatitis C     105880942 (IFNG)    05164 Influenza A     105880942 (IFNG)    05168 Herpes simplex virus 1 infection     105880942 (IFNG)   09171 Infectious disease: bacterial    05152 Tuberculosis     105880942 (IFNG)   09174 Infectious disease: parasitic    05146 Amoebiasis     105880942 (IFNG)    05144 Malaria     105880942 (IFNG)    05145 Toxoplasmosis     105880942 (IFNG)    05140 Leishmaniasis     105880942 (IFNG)    05142 Chagas disease     105880942 (IFNG)    05143 African trypanosomiasis     105880942 (IFNG)   09163 Immune disease    05322 Systemic lupus erythematosus     105880942 (IFNG)    05323 Rheumatoid arthritis     105880942 (IFNG)    05321 Inflammatory bowel disease     105880942 (IFNG)    05330 Allograft rejection     105880942 (IFNG)    05332 Graft-versus-host disease     105880942 (IFNG)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     105880942 (IFNG)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     105880942 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:mmur03051]     105880942 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mmur04052]     105880942 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:mmur00536]     105880942 (IFNG) Proteasome [BR:mmur03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     105880942 (IFNG) Cytokines and neuropeptides [BR:mmur04052]  Cytokines   Interferons    105880942 (IFNG) Glycosaminoglycan binding proteins [BR:mmur00536]  Heparan sulfate / Heparin   Cytokines    105880942 (IFNG) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IFN-gamma API5 Mating_N Nop52 Motif Other DBs NCBI-GeneID:  105880942 NCBI-ProteinID:  XP_012637806 Ensembl:  ENSMICG00000004223 UniProt:  A0A8C5UTE7 LinkDB All DBs Position 7:complement(77477656..77482008) Genome browser AA seq 166 aa AA seqDB search MNYTSYILVVQLCILLGSSGCYCQGAFFKEIDDLKEYFNASGPDVADGRNVFLDILKKWK EESDKKIIQSQIVSFYFKLFENHKDNQTIKKSMETIKEDLIAKLFNGSRSKLEDFQQLTK LSLNDPQVQRKAISELHHVMNDLSSRTNQRKRKRSQMPFRGRRASK NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atgaattacacaagttatatcttggttgttcagctctgtatccttttgggttcttcgggc tgttactgccagggtgcattttttaaagaaatagacgaccttaaggaatattttaatgca agtggtccagatgtagcagatggtaggaatgttttcctagatattttgaagaaatggaaa gaggagagtgacaaaaaaataattcagagccaaattgtgtccttctacttcaaactcttt gaaaatcataaagacaaccagaccatcaaaaagagtatggagaccatcaaggaagatctg attgccaagcttttcaatggcagccgcagcaaactggaggactttcaacagctgactaaa ctttcgttaaatgacccacaggtccagcgtaaagccataagtgaactccaccacgtgatg aacgacttgtcgtcgagaaccaaccaaagaaagcgaaaaagaagtcagatgccgtttcga ggtcggagagcatccaaataa

DBGET integrated database retrieval system