Microcebus murinus (gray mouse lemur): 105884566 Help Entry 105884566         CDS       T07238                                  Symbol POLE4 Name (RefSeq) DNA polymerase epsilon subunit 4   KO K03506   DNA polymerase epsilon subunit 4 [EC:2.7.7.7] Organism mmur  Microcebus murinus (gray mouse lemur) Pathway mmur03030   DNA replication mmur03410   Base excision repair mmur03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:mmur00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     105884566 (POLE4)    03410 Base excision repair     105884566 (POLE4)    03420 Nucleotide excision repair     105884566 (POLE4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:mmur03032]     105884566 (POLE4)    03400 DNA repair and recombination proteins [BR:mmur03400]     105884566 (POLE4) Enzymes [BR:mmur01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      105884566 (POLE4) DNA replication proteins [BR:mmur03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     105884566 (POLE4) DNA repair and recombination proteins [BR:mmur03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       105884566 (POLE4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone TAF CENP-T_C Motif Other DBs NCBI-GeneID:  105884566 NCBI-ProteinID:  XP_012644034 Ensembl:  ENSMICG00000035864 UniProt:  A0A8C6EI89 LinkDB All DBs Position 4:20653534..20659201 Genome browser AA seq 116 aa AA seqDB search MAAAAAGSGTPREEEGAGGEAATPQPQAPTSAPGARLSRLPLARVKALVKADPDVTLAGQ EAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGTLD NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggcggcggcggcagctggcagcgggactccccgggaggaggaaggagctggtggagag gcagcgactccgcagccccaagccccgactagtgcgcctggggctcgtctctcgaggctg cctctggcgcgagtgaaagccttggtgaaggcggaccccgacgtgacgctggcaggacag gaagccatctttatcctggcgcgagcggcggaactgtttgtggagaccattgcaaaagat gcctactgctgtgctcaacaaggaaagaggaaaaccctccagaggagagatttggataat gcaatagaagcagtggatgaatttgcttttctggaaggtactttggattga

DBGET integrated database retrieval system