Microcebus murinus (gray mouse lemur): 105884969 Help Entry 105884969         CDS       T07238                                  Symbol ACTG1 Name (RefSeq) actin, cytoplasmic 2   KO K05692   actin beta/gamma 1 Organism mmur  Microcebus murinus (gray mouse lemur) Pathway mmur03082   ATP-dependent chromatin remodeling mmur04015   Rap1 signaling pathway mmur04145   Phagosome mmur04210   Apoptosis mmur04390   Hippo signaling pathway mmur04510   Focal adhesion mmur04520   Adherens junction mmur04530   Tight junction mmur04611   Platelet activation mmur04613   Neutrophil extracellular trap formation mmur04670   Leukocyte transendothelial migration mmur04714   Thermogenesis mmur04810   Regulation of actin cytoskeleton mmur04814   Motor proteins mmur04820   Cytoskeleton in muscle cells mmur04919   Thyroid hormone signaling pathway mmur04921   Oxytocin signaling pathway mmur04971   Gastric acid secretion mmur05014   Amyotrophic lateral sclerosis mmur05100   Bacterial invasion of epithelial cells mmur05132   Salmonella infection mmur05135   Yersinia infection mmur05164   Influenza A mmur05205   Proteoglycans in cancer mmur05225   Hepatocellular carcinoma mmur05410   Hypertrophic cardiomyopathy mmur05412   Arrhythmogenic right ventricular cardiomyopathy mmur05414   Dilated cardiomyopathy mmur05416   Viral myocarditis mmur05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mmur00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     105884969 (ACTG1)  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     105884969 (ACTG1)    04390 Hippo signaling pathway     105884969 (ACTG1)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     105884969 (ACTG1)   09143 Cell growth and death    04210 Apoptosis     105884969 (ACTG1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     105884969 (ACTG1)    04520 Adherens junction     105884969 (ACTG1)    04530 Tight junction     105884969 (ACTG1)   09142 Cell motility    04814 Motor proteins     105884969 (ACTG1)    04820 Cytoskeleton in muscle cells     105884969 (ACTG1)    04810 Regulation of actin cytoskeleton     105884969 (ACTG1)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     105884969 (ACTG1)    04613 Neutrophil extracellular trap formation     105884969 (ACTG1)    04670 Leukocyte transendothelial migration     105884969 (ACTG1)   09152 Endocrine system    04921 Oxytocin signaling pathway     105884969 (ACTG1)    04919 Thyroid hormone signaling pathway     105884969 (ACTG1)   09154 Digestive system    04971 Gastric acid secretion     105884969 (ACTG1)   09159 Environmental adaptation    04714 Thermogenesis     105884969 (ACTG1)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     105884969 (ACTG1)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     105884969 (ACTG1)   09172 Infectious disease: viral    05164 Influenza A     105884969 (ACTG1)   09171 Infectious disease: bacterial    05132 Salmonella infection     105884969 (ACTG1)    05135 Yersinia infection     105884969 (ACTG1)    05100 Bacterial invasion of epithelial cells     105884969 (ACTG1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     105884969 (ACTG1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     105884969 (ACTG1)    05410 Hypertrophic cardiomyopathy     105884969 (ACTG1)    05412 Arrhythmogenic right ventricular cardiomyopathy     105884969 (ACTG1)    05414 Dilated cardiomyopathy     105884969 (ACTG1)    05416 Viral myocarditis     105884969 (ACTG1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:mmur03021]     105884969 (ACTG1)    03019 Messenger RNA biogenesis [BR:mmur03019]     105884969 (ACTG1)    03036 Chromosome and associated proteins [BR:mmur03036]     105884969 (ACTG1)    03029 Mitochondrial biogenesis [BR:mmur03029]     105884969 (ACTG1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mmur04812]     105884969 (ACTG1)    04147 Exosome [BR:mmur04147]     105884969 (ACTG1) Transcription machinery [BR:mmur03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      105884969 (ACTG1) Messenger RNA biogenesis [BR:mmur03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      105884969 (ACTG1) Chromosome and associated proteins [BR:mmur03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      105884969 (ACTG1)     NuA4 complex      105884969 (ACTG1)   Chromatin remodeling factors    BAF complex     105884969 (ACTG1)    PBAF complex     105884969 (ACTG1)    GBAF(ncBAF) complex     105884969 (ACTG1)    SWR1 complex     105884969 (ACTG1) Mitochondrial biogenesis [BR:mmur03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     105884969 (ACTG1) Cytoskeleton proteins [BR:mmur04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      105884969 (ACTG1) Exosome [BR:mmur04147]  Exosomal proteins   Proteins found in most exosomes    105884969 (ACTG1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Actin Motif Other DBs NCBI-GeneID:  105884969 NCBI-ProteinID:  XP_012644914 Ensembl:  ENSMICG00000014863 UniProt:  A0A8C5XMT5 LinkDB All DBs Position 16:1424098..1426928 Genome browser AA seq 375 aa AA seqDB search MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ EYDESGPSIVHRKCF NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt atggaagaggaaatcgccgcgctcgtcattgacaatggctccggcatgtgcaaagctggc tttgctggggacgacgccccccgagccgtgttcccgtccatcgtcggccgcccgcggcac cagggcgtgatggtgggcatgggccagaaggactcgtacgtgggcgacgaggcccagagc aagcgcggcatcctgaccctgaagtaccccatcgagcacggcatcgtcaccaactgggac gacatggagaagatctggcaccacaccttctacaacgagctgcgcgtggcccccgaggag cacccggtgctgctgaccgaggcccctctgaaccccaaggccaacagagagaagatgacc cagatcatgtttgagaccttcaacacccccgccatgtacgtggccatccaggcggtgctg tccctgtacgcctctggccgcaccactggcattgtcatggactctggagacggggtcacc cacacggtgcccatctacgaggggtacgccctcccccacgccatcctgcgtctggacctg gcgggccgggacctgacggactacctcatgaagatcctcacggagcgcggctacagcttc accaccaccgccgagcgggagattgtgcgcgacatcaaggagaagctgtgctacgttgcc ctggacttcgagcaggagatggccaccgccgcgtcctcctcctccttggagaagagctat gagctgcccgacggccaggtgatcaccatcggcaacgagcggttccggtgtccagaggcg ctcttccagccgtccttcctgggcatggagtcatgtggcatccacgagacgaccttcaac tccatcatgaagtgcgacgtggacatccgcaaggacctgtacgccaacacggtactgtct gggggcaccaccatgtacccgggcatcgccgacaggatgcagaaggagatcaccgccctg gcacccagcaccatgaagatcaagatcatcgcgccccctgagcgcaagtactccgtgtgg atcggcggctccatcctggcctcgctgtccaccttccagcagatgtggatcagcaagcag gagtacgacgagtccgggccctccatcgtccaccgcaaatgcttctag

DBGET integrated database retrieval system