Microcebus murinus (gray mouse lemur): 105885453 Help Entry 105885453         CDS       T07238                                  Name (RefSeq) CD209 antigen-like   KO K06563   C-type lectin domain family 4 member L/M Organism mmur  Microcebus murinus (gray mouse lemur) Pathway mmur03260   Virion - Human immunodeficiency virus mmur03264   Virion - Flavivirus and Alphavirus mmur03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus mmur03273   Virion - Lassa virus and SFTS virus mmur04145   Phagosome mmur04625   C-type lectin receptor signaling pathway mmur05152   Tuberculosis mmur05162   Measles Brite KEGG Orthology (KO) [BR:mmur00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     105885453    03264 Virion - Flavivirus and Alphavirus     105885453    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     105885453    03273 Virion - Lassa virus and SFTS virus     105885453  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     105885453  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     105885453  09160 Human Diseases   09172 Infectious disease: viral    05162 Measles     105885453   09171 Infectious disease: bacterial    05152 Tuberculosis     105885453  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mmur04131]     105885453   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:mmur04054]     105885453    04515 Cell adhesion molecules [BR:mmur04515]     105885453    04090 CD molecules [BR:mmur04090]     105885453    04091 Lectins [BR:mmur04091]     105885453 Membrane trafficking [BR:mmur04131]  Endocytosis   Phagocytosis    C-lectin receptors     105885453 Pattern recognition receptors [BR:mmur04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    105885453 Cell adhesion molecules [BR:mmur04515]  Lectins   Selectins and C-type lectins    105885453 CD molecules [BR:mmur04090]  Proteins   105885453 Lectins [BR:mmur04091]  C-Type lectins   Asialoglycoprotein and DC receptors    105885453 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Lectin_C Methyltransf_FA Motif Other DBs NCBI-GeneID:  105885453 NCBI-ProteinID:  XP_012645814 LinkDB All DBs Position 24:6554269..6557168 Genome browser AA seq 135 aa AA seqDB search MRLDIFQLGVTGEQRIQDVGAQLVVIKGDEEQNFLQLQSAGRNRVSWIGMSDMTHEGSWQ WVDGSPLPPSFTKHWQQNQPDNFKNEDCVELIDSGWNDQKCNAARFWICKMSAASCPSEQ GRVPASTAAPTLSAQ NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atgcggctggacatattccagttgggtgtcacaggggagcagcgtatacaggacgtgggg gcccagctggtggtcatcaaaggcgatgaggagcagaactttctacagctgcagagtgct gggaggaaccgcgtatcctggatcgggatgtcagacatgacccacgaaggctcgtggcag tgggtggacggctcgcctcttccgcccagcttcaccaagcactggcagcagaatcagccc gacaacttcaagaacgaagactgtgtggagcttatagacagtggctggaatgaccagaaa tgcaatgctgccagattctggatctgcaaaatgtctgcggcctcctgccccagcgagcaa gggcgggttcccgcctccaccgctgccccaaccctgtctgctcaatag

DBGET integrated database retrieval system