Myotis myotis (greater mouse-eared bat): 118656030 Help Entry 118656030         CDS       T07220                                  Name (RefSeq) dihydrofolate reductase-like   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism mmyo  Myotis myotis (greater mouse-eared bat) Pathway mmyo00670   One carbon pool by folate mmyo00790   Folate biosynthesis mmyo01100   Metabolic pathways mmyo01240   Biosynthesis of cofactors mmyo01523   Antifolate resistance mmyo04981   Folate transport and metabolism Brite KEGG Orthology (KO) [BR:mmyo00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     118656030    00670 One carbon pool by folate     118656030  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     118656030  09160 Human Diseases   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     118656030 Enzymes [BR:mmyo01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      118656030 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-GeneID:  118656030 NCBI-ProteinID:  XP_036164596 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MVRDSIKFVVDEAFSAAVMVRTLNCIAAVSQNMGIGKNGDLPWPPLRNEFKYFQRMTTTS SAKVLLHCNAFTLLIQNFQLYFYCEEKKKCTNYLGIFQNTLHLVPAPCGTCMEKHE NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggtaagagacagcataaaatttgttgtagatgaggcttttagtgccgccgtcatggtt cgtactctcaactgcatcgccgctgtgtcccagaacatgggcattggcaagaacggagac ctgccttggcccccgctcaggaatgaattcaagtatttccaaagaatgaccacaacctct tcagcaaaagttttgttacactgcaatgcatttacactcctgattcagaacttccagctc tacttctactgtgaagaaaaaaaaaagtgcacaaactatcttgggatttttcaaaacact ctgcatcttgtgcctgcaccttgtggaacttgcatggaaaagcatgagtaa

DBGET integrated database retrieval system