Myotis myotis (greater mouse-eared bat): 118665292 Help Entry 118665292         CDS       T07220                                  Symbol RELA Name (RefSeq) transcription factor p65   KO K04735   transcription factor p65 Organism mmyo  Myotis myotis (greater mouse-eared bat) Pathway mmyo01523   Antifolate resistance mmyo04010   MAPK signaling pathway mmyo04014   Ras signaling pathway mmyo04024   cAMP signaling pathway mmyo04062   Chemokine signaling pathway mmyo04064   NF-kappa B signaling pathway mmyo04066   HIF-1 signaling pathway mmyo04071   Sphingolipid signaling pathway mmyo04137   Mitophagy - animal mmyo04151   PI3K-Akt signaling pathway mmyo04210   Apoptosis mmyo04211   Longevity regulating pathway mmyo04218   Cellular senescence mmyo04380   Osteoclast differentiation mmyo04613   Neutrophil extracellular trap formation mmyo04620   Toll-like receptor signaling pathway mmyo04621   NOD-like receptor signaling pathway mmyo04622   RIG-I-like receptor signaling pathway mmyo04623   Cytosolic DNA-sensing pathway mmyo04625   C-type lectin receptor signaling pathway mmyo04657   IL-17 signaling pathway mmyo04658   Th1 and Th2 cell differentiation mmyo04659   Th17 cell differentiation mmyo04660   T cell receptor signaling pathway mmyo04662   B cell receptor signaling pathway mmyo04668   TNF signaling pathway mmyo04722   Neurotrophin signaling pathway mmyo04917   Prolactin signaling pathway mmyo04920   Adipocytokine signaling pathway mmyo04926   Relaxin signaling pathway mmyo04931   Insulin resistance mmyo04932   Non-alcoholic fatty liver disease mmyo04933   AGE-RAGE signaling pathway in diabetic complications mmyo04936   Alcoholic liver disease mmyo05010   Alzheimer disease mmyo05022   Pathways of neurodegeneration - multiple diseases mmyo05030   Cocaine addiction mmyo05132   Salmonella infection mmyo05133   Pertussis mmyo05134   Legionellosis mmyo05135   Yersinia infection mmyo05140   Leishmaniasis mmyo05142   Chagas disease mmyo05145   Toxoplasmosis mmyo05146   Amoebiasis mmyo05152   Tuberculosis mmyo05160   Hepatitis C mmyo05161   Hepatitis B mmyo05162   Measles mmyo05163   Human cytomegalovirus infection mmyo05164   Influenza A mmyo05165   Human papillomavirus infection mmyo05166   Human T-cell leukemia virus 1 infection mmyo05167   Kaposi sarcoma-associated herpesvirus infection mmyo05168   Herpes simplex virus 1 infection mmyo05169   Epstein-Barr virus infection mmyo05170   Human immunodeficiency virus 1 infection mmyo05171   Coronavirus disease - COVID-19 mmyo05200   Pathways in cancer mmyo05202   Transcriptional misregulation in cancer mmyo05203   Viral carcinogenesis mmyo05207   Chemical carcinogenesis - receptor activation mmyo05208   Chemical carcinogenesis - reactive oxygen species mmyo05212   Pancreatic cancer mmyo05215   Prostate cancer mmyo05220   Chronic myeloid leukemia mmyo05221   Acute myeloid leukemia mmyo05222   Small cell lung cancer mmyo05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mmyo05321   Inflammatory bowel disease mmyo05415   Diabetic cardiomyopathy mmyo05417   Lipid and atherosclerosis mmyo05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mmyo00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     118665292 (RELA)    04014 Ras signaling pathway     118665292 (RELA)    04064 NF-kappa B signaling pathway     118665292 (RELA)    04668 TNF signaling pathway     118665292 (RELA)    04066 HIF-1 signaling pathway     118665292 (RELA)    04071 Sphingolipid signaling pathway     118665292 (RELA)    04024 cAMP signaling pathway     118665292 (RELA)    04151 PI3K-Akt signaling pathway     118665292 (RELA)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     118665292 (RELA)   09143 Cell growth and death    04210 Apoptosis     118665292 (RELA)    04218 Cellular senescence     118665292 (RELA)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     118665292 (RELA)    04620 Toll-like receptor signaling pathway     118665292 (RELA)    04621 NOD-like receptor signaling pathway     118665292 (RELA)    04622 RIG-I-like receptor signaling pathway     118665292 (RELA)    04623 Cytosolic DNA-sensing pathway     118665292 (RELA)    04625 C-type lectin receptor signaling pathway     118665292 (RELA)    04660 T cell receptor signaling pathway     118665292 (RELA)    04658 Th1 and Th2 cell differentiation     118665292 (RELA)    04659 Th17 cell differentiation     118665292 (RELA)    04657 IL-17 signaling pathway     118665292 (RELA)    04662 B cell receptor signaling pathway     118665292 (RELA)    04062 Chemokine signaling pathway     118665292 (RELA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     118665292 (RELA)    04917 Prolactin signaling pathway     118665292 (RELA)    04926 Relaxin signaling pathway     118665292 (RELA)   09156 Nervous system    04722 Neurotrophin signaling pathway     118665292 (RELA)   09158 Development and regeneration    04380 Osteoclast differentiation     118665292 (RELA)   09149 Aging    04211 Longevity regulating pathway     118665292 (RELA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     118665292 (RELA)    05202 Transcriptional misregulation in cancer     118665292 (RELA)    05207 Chemical carcinogenesis - receptor activation     118665292 (RELA)    05208 Chemical carcinogenesis - reactive oxygen species     118665292 (RELA)    05203 Viral carcinogenesis     118665292 (RELA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     118665292 (RELA)   09162 Cancer: specific types    05212 Pancreatic cancer     118665292 (RELA)    05221 Acute myeloid leukemia     118665292 (RELA)    05220 Chronic myeloid leukemia     118665292 (RELA)    05215 Prostate cancer     118665292 (RELA)    05222 Small cell lung cancer     118665292 (RELA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     118665292 (RELA)    05170 Human immunodeficiency virus 1 infection     118665292 (RELA)    05161 Hepatitis B     118665292 (RELA)    05160 Hepatitis C     118665292 (RELA)    05171 Coronavirus disease - COVID-19     118665292 (RELA)    05164 Influenza A     118665292 (RELA)    05162 Measles     118665292 (RELA)    05168 Herpes simplex virus 1 infection     118665292 (RELA)    05163 Human cytomegalovirus infection     118665292 (RELA)    05167 Kaposi sarcoma-associated herpesvirus infection     118665292 (RELA)    05169 Epstein-Barr virus infection     118665292 (RELA)    05165 Human papillomavirus infection     118665292 (RELA)   09171 Infectious disease: bacterial    05132 Salmonella infection     118665292 (RELA)    05135 Yersinia infection     118665292 (RELA)    05133 Pertussis     118665292 (RELA)    05134 Legionellosis     118665292 (RELA)    05152 Tuberculosis     118665292 (RELA)   09174 Infectious disease: parasitic    05146 Amoebiasis     118665292 (RELA)    05145 Toxoplasmosis     118665292 (RELA)    05140 Leishmaniasis     118665292 (RELA)    05142 Chagas disease     118665292 (RELA)   09163 Immune disease    05321 Inflammatory bowel disease     118665292 (RELA)   09164 Neurodegenerative disease    05010 Alzheimer disease     118665292 (RELA)    05022 Pathways of neurodegeneration - multiple diseases     118665292 (RELA)   09165 Substance dependence    05030 Cocaine addiction     118665292 (RELA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     118665292 (RELA)    05418 Fluid shear stress and atherosclerosis     118665292 (RELA)    05415 Diabetic cardiomyopathy     118665292 (RELA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     118665292 (RELA)    04932 Non-alcoholic fatty liver disease     118665292 (RELA)    04931 Insulin resistance     118665292 (RELA)    04933 AGE-RAGE signaling pathway in diabetic complications     118665292 (RELA)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     118665292 (RELA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mmyo03000]     118665292 (RELA) Transcription factors [BR:mmyo03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Rel/Ankyrin     118665292 (RELA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RHD_DNA_bind RHD_dimer Motif Other DBs NCBI-GeneID:  118665292 NCBI-ProteinID:  XP_036182518 LinkDB All DBs Position Unknown AA seq 547 aa AA seqDB search MDDLFPLIFPSEPAQAPGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT IKIIGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC VKKRDLEQAISQRIQTNNNPFQVPMEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLSPVLS HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE KRKRTYETFKSIMKKSPFNGPTDPRPPPRRIAVPSRSSTSVPKPAPQPYPFTPSLSTINF EEFSPMVFSSGQIPNQPSALAPALVSAMTPALVQGPAPAPAPVPVIASASSLAQAVAPPA PKPTQAGEGTLTEALLHLQFDADEDLGALLGNNTDPAVFTDLASVDNSEFQQMLNQGVSM APHTAEPMLMEYPEAITRLVTGSQNPPDPAPAPLGAAGLANGLLSGDEDFSSIADMDFSA LLSQISS NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt atggacgacctgttccccctcatcttcccctccgagcccgcccaggccccgggcccctac gtggagatcatcgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggc cgctcggcgggcagtatccccggcgagaggagcaccgataccaccaagacccaccccacc attaagatcattggctacacggggccggggacggttcgcatctctctggtcaccaaggac cccccgcaccggcctcacccccacgagctggtcgggaaagactgccgggatggcttctat gaggccgagctctgcccggaccgctgcatccacagcttccagaacctggggatccaatgt gtgaagaagcgggacctggagcaggccatcagtcagcgcatccagaccaacaacaacccc ttccaagttcccatggaagagcagcgcggagactacgacttgaatgctgtgcggctctgc ttccaggtgacagtgcgggacccatcaggcaggcccctccgcctgtcacctgtcctctct catcccatctttgacaaccgcgcccccaacacagcagagctcaagatctgccgagtgaac cggaactccgggagctgcctcgggggggacgagatcttcctgctgtgtgacaaggtgcag aaagaggacatcgaagtgtatttcacgggaccgggctgggaggcccggggctccttttca caagccgatgtacaccgacaagtggccattgtgttccggacacctccctacgcagacccc agcctgcaggcccccgtgcgcgtctccatgcagctgcggcggccttcagatcgggagctc agcgagcccatggaattccagtacttgccagacacagatgatcgtcaccggattgaggag aagcgcaaaaggacatacgagaccttcaagagcatcatgaagaagagtcctttcaatgga cccaccgacccccggcctcctccccggcgcattgccgtgccttcccgcagctcaacttcc gtccctaagccagctccccagccctatccctttacgccatccctcagcaccatcaacttt gaggagttttcccccatggtcttttcttctgggcagatcccaaaccagccctcagccttg gcaccagcccttgtctcagccatgacaccagctctggttcagggcccagccccagcccca gcccctgtcccagtcatagcctcagcctccagccttgctcaggctgtggctccgcctgcc cccaagcccacccaggcaggggaaggaacactgacagaggccctgctacatctgcagttt gatgctgatgaagacctgggggccctgctgggcaataatactgacccagccgtgttcacg gacctggcctccgtcgacaactctgagtttcagcagatgctgaaccagggtgtctctatg gctccccacacagcggagcccatgctaatggagtaccctgaggctataacacgcctggtg acagggtcccagaatccccctgacccagctcctgctcccctgggggccgctggcctcgcc aacggcctcctctcaggggatgaagacttttcctccatcgcagacatggacttctcagcc ctactgagtcaaatcagctcctaa

DBGET integrated database retrieval system