KEGG   Miniopterus natalensis (Natal long-fingered bat): 107524058
Entry
107524058         CDS       T05883                                 
Symbol
WFS1
Name
(RefSeq) wolframin
  KO
K14020  wolfamin
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107524058 (WFS1)
SSDB
Motif
Pfam: WC-rich WCOB WSLR WEF-hand HTH_16
Other DBs
NCBI-GeneID: 107524058
NCBI-ProteinID: XP_016051274
LinkDB
Position
Unknown
AA seq 888 aa
MDSSAPSPSPSSPQPSPPPQPQARSRLNGTSSVKQEKNGAPQAPGPQVGPGPDVRDSVAP
AVPQALRARSRERADGTGPSKGDMETPFEEVLEKAKAGDPKAQTEVGKRYLQLAGEQDEE
LNSCTAVDWLTLAAKQGRREAVKLLRRCLADRKGITSENEQEVRQLSSETDLERAVRKAA
LVMYWKLNPKKKKQVAVSELLENVDQVNEHHGGAQPGPVPKSLQKQRRVLERLVSSESKN
YIALDDFVEITKKYAKGVIPTNLFLQDDDDDDELGGKSPDDLPLHLKVVKYPLHAVMEIK
EYLIEMASRVGMHWLSTVVPTHHINALLVFFIISNLTIDFFAFCVPLVVFYLSFVSMVIC
TLKVFQDSKAWESFRALTNLLLRFEPNLDVEQAEANFGWNHLEPYVYFLLSVVFVVFSFP
IASKDCIPCSELAVVSVFFTVASYMSLSTSAEPYTRQALVTEVAAGLLSLLPTLPFDWRY
LKLLGQTLVTVPVGHLVVLNVSLPCLLYVYLLFLFFRMAQLRAFKGTYCYLVPYLVCFMW
CELSVVILLESTGLGLVRASIGYFLFLFALPVLVAGLALMGLVKFALWFLSLELTKIAVT
MVVCSIPLLFRWWTKANLSVVGMVKSLTRSSIVKLILVWITAIVLFCWFYVYRSEGMKVY
NSTLTWQQYGFLCGPRAWKETNMARTQILCSHLEGHRVTWTGRFKYVRVTDIDNSAESAI
NMLPFVVGDWMRCLYGEAYPACSPGSASTAEEELCRLKLLAKHPCHIKKFDRYKFEITVG
MPFGTNGTRGPEEDDVTKDIVLRASSEFKDVLLHLRQGSLIEFSTVLEGRLGSKWPVFEL
KAISCLNCMAQLSAARRHVKIEQDWRSTVHSATKFAFDFFFFPFLSAV
NT seq 2667 nt   +upstreamnt  +downstreamnt
atggactccagcgccccctctccaagcccctccagcccacagccttcgccgcccccacag
ccccaggcccgctcacggctcaatggcacatcctcagtgaaacaggagaagaatggggca
ccccaagctcctggaccccaagttggacctggaccagatgtgagagactcagtggcccca
gcggtgccccaggcccttcgtgccaggagccgagaaagggcagatggaacagggccctca
aagggagatatggaaaccccctttgaagaagtcctggagaaggccaaggcaggggacccc
aaggcacagacggaggtggggaagcgctacctgcagctggcgggagagcaggacgaggag
ctcaacagctgcacagctgtggactggctgaccttggccgccaagcagggccggcgcgag
gccgtcaagctgctccgccgctgcctggccgacaggaaaggcatcacttccgagaacgag
caggaggtgaggcagctctcctccgagactgacctggagcgggcggtgcgcaaggcggcc
ctggtcatgtactggaagctcaaccccaagaagaagaagcaggtggccgtgtccgagctg
ctggagaacgtcgaccaggtcaacgagcaccatggaggggcacagccaggccctgtcccc
aagtcgctgcagaagcagaggcgggtgttggagcgcttggtcagcagtgaatccaagaac
tacatcgcgctggacgacttcgtggagatcaccaagaagtacgccaagggcgtcatcccc
accaacctgttcctgcaagacgacgacgacgacgacgagctgggcggcaagagccccgac
gacctgcccctgcacctgaaggtggtcaagtaccccttgcacgcggtcatggagatcaag
gagtacctgatcgaaatggcctcccgggtgggcatgcactggctgagcaccgtggtcccc
acccaccacatcaacgccctgctcgtcttcttcatcatcagcaacctcaccatcgacttc
tttgccttctgcgtcccgctggtcgtcttctacctgtccttcgtctccatggtgatctgc
accctcaaggtcttccaggacagcaaggcctgggagagcttccgcgccctcaccaacctg
ctgctgcgcttcgagcccaacctggacgtggagcaggccgaggcgaacttcggctggaac
cacctggagccctacgtctacttcctgctgtccgtcgtctttgtggtcttctccttcccc
atcgccagcaaggactgcatcccctgctccgagctggccgtggtgtccgtcttcttcact
gtcgccagctacatgagcctgagcacctccgccgagccctacacccggcaggccctggtc
accgaggtggccgccggcctgctttccctcctgcccaccctgcccttcgactggcgctac
ctgaagttgctgggccagaccttggtcaccgtgcccgtcggccacctggtcgtgctgaat
gtgagcctgccctgcctgctctacgtctacctgctcttccttttcttccgcatggcccag
ctgcgggccttcaagggcacctactgctacctggttccctacctggtctgcttcatgtgg
tgcgagctctccgtggtcatcctgctcgagtctaccggcctggggctggtccgcgcctcc
atcggctacttcctcttcctcttcgcgctcccggtgctggtggccggcctggcgctcatg
ggcttggtgaagtttgcgctctggttcctgtcgctggagctcaccaagatcgccgtcacc
atggtggtctgcagcatccccctgctcttccgctggtggaccaaggccaacctgtccgtg
gtggggatggtcaagtccctgacgcggagctccatcgtcaagctcatcctggtgtggatc
acagccatcgtgctgttctgctggttctacgtgtaccgctcggagggcatgaaggtgtac
aactccaccctcacctggcagcagtacggcttcctgtgcgggccgcgggcctggaaggag
accaacatggcgcgcacccagatcctctgcagccacctggagggccaccgcgtcacctgg
acgggccgcttcaagtatgtccgggtcacggacatcgacaacagtgccgagtcggccatc
aacatgctcccgttcgtcgtcggcgactggatgcgctgcctgtatggcgaggcctacccc
gcctgcagcccgggcagcgcctccacggccgaagaggagctctgccgcctcaagctgctg
gccaagcacccctgccacatcaagaagttcgaccgctacaagttcgagatcacggtgggc
atgcccttcggcaccaacggcacccgcggccccgaggaggatgacgtcaccaaggacatc
gtgctgcgggccagcagcgagttcaaggacgtgctgctgcacctgcgccagggcagcctc
atcgagttcagcactgtgctggagggccgcctgggcagcaagtggcccgtctttgagctc
aaggccatcagctgcctcaactgcatggcccagctgtccgcggcccggcggcacgtgaag
atcgagcaggactggcgcagcaccgtgcacagcgccacgaagttcgccttcgacttcttc
ttcttccccttcctgtcggccgtgtga

DBGET integrated database retrieval system