KEGG   Miniopterus natalensis: 107527910
Entry
107527910         CDS       T05883                                 

Definition
(RefSeq) neuronal acetylcholine receptor subunit alpha-7
  KO
K04809  nicotinic acetylcholine receptor alpha-7
Organism
mna  Miniopterus natalensis
Pathway
mna04020  Calcium signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04725  Cholinergic synapse
mna05010  Alzheimer disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05033  Nicotine addiction
mna05207  Chemical carcinogenesis - receptor activation
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107527910
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107527910
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    107527910
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    107527910
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107527910
   05022 Pathways of neurodegeneration - multiple diseases
    107527910
  09165 Substance dependence
   05033 Nicotine addiction
    107527910
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mna04040]
    107527910
Ion channels [BR:mna04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   107527910
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 107527910
NCBI-ProteinID: XP_016056296
LinkDB
Position
Unknown
AA seq 349 aa
MRRSVWLALAASLLHVSLQGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIM
DVDEKNQVLTTNIWLQMSWTDHYLQWNTSEYPGVKTVRFPDGQIWKPDILLYNSADERFD
ATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQQCKLKFGSWSYGGWSLDLQMQ
EADISGYIPNGEWDLMGIPGKRSEKFYECCKEPYPDVTFTVTIRRRTLYYGLNLLIPCVL
ISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMII
VGLSVVVTVIVLQYHHHDPDGGQMPKWVRSSRPPCSGSGALPKGGAMNG
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgcgccgctcggtctggctggcgctggcggcgtcgctcctgcacgtgtccctgcaaggc
gagttccagaggaagctctacaaggagctggtcaagaactacaaccccttggagaggccc
gtggccaacgactcgcagccgctcaccgtctacttctccctgagtctcctgcagatcatg
gacgtggacgagaagaaccaagttctaaccaccaacatctggctgcagatgtcctggaca
gatcactacctgcagtggaacacatcggagtacccgggcgtgaagactgtgcgctttccg
gacgggcagatctggaagccagacattcttctgtacaacagtgccgatgagcgatttgat
gccaccttccacaccaacgtgttagtgaattcttccgggcattgccagtacctccctcca
ggcatattcaagagctcctgctacatcgatgtgcgctggttcccttttgacgtgcagcag
tgcaagctgaagtttggatcctggtcctacggaggctggtccttggatctgcagatgcag
gaggcggatatcagtggctacatccccaacggagaatgggacctcatgggaatcccgggc
aagcgcagtgagaagttctatgagtgctgtaaggagccctaccccgacgtcaccttcaca
gtgaccatccgccgcaggaccctctactacggcctcaacctcctcatcccctgcgtgctc
atctctgccctggccctgctggtcttcctgctccccgcagactctggagagaaaatctcc
ctcgggataactgttttgctctctctcaccgtgttcatgcttctggtggccgagatcatg
cctgcaacatccgactcagtgcccttgatagcccagtacttcgccagcaccatgatcatc
gtgggcctctccgtggtcgtcacggtgattgtgctgcagtaccaccaccacgaccctgac
ggcggccagatgcccaagtgggtgcgttcctcccgccctccctgcagcgggtcaggggcc
ctccccaaaggaggcgccatgaatgggtga

DBGET integrated database retrieval system