KEGG   Miniopterus natalensis: 107528876
Entry
107528876         CDS       T05883                                 

Gene name
MAP3K14
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04064  NF-kappa B signaling pathway
mna04210  Apoptosis
mna04380  Osteoclast differentiation
mna04625  C-type lectin receptor signaling pathway
mna04660  T cell receptor signaling pathway
mna04668  TNF signaling pathway
mna04672  Intestinal immune network for IgA production
mna05166  Human T-cell leukemia virus 1 infection
mna05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107528876 (MAP3K14)
   04064 NF-kappa B signaling pathway
    107528876 (MAP3K14)
   04668 TNF signaling pathway
    107528876 (MAP3K14)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107528876 (MAP3K14)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107528876 (MAP3K14)
   04660 T cell receptor signaling pathway
    107528876 (MAP3K14)
   04672 Intestinal immune network for IgA production
    107528876 (MAP3K14)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107528876 (MAP3K14)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107528876 (MAP3K14)
   05169 Epstein-Barr virus infection
    107528876 (MAP3K14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107528876 (MAP3K14)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     107528876 (MAP3K14)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: STE group
  Other
   107528876 (MAP3K14)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH TCAD9
Other DBs
NCBI-GeneID: 107528876
NCBI-ProteinID: XP_016057543
LinkDB
Position
Unknown
AA seq 953 aa
MAVMEMACPGAPGSTVGQQKELAKAKKTQAMGKKQSSVHKLEAVEKSPVFCGKWEILNDV
ITKGTAKEGSEGGPAAISIIAQAECENSQEFSPTFSERIFIAGSKQYSQSESLDQIPNNV
AHATEGKMARVCWKGKRRSKARKKRKKKSSKSLAQAGVALARPLPRTPEQESCTVPVQED
ESPLGTPYIRSAPQFTNPLKEPDLGQLCFKKLGEGLRPALPRSELHKLISPLQCLNHVWK
LHYPQDAGPLPQLAHPFPYNRLPHPFPFHPLQPWKPHPLESFLGKLACVDSHQPLPGPPL
GKLACIDSQKPLPGPPLEPSCPLRGTHEKFSVEEYLVHALQGSVSSGQAHSLASLAKTWS
AGGSRPQKPSPKTEDSEGVLLTEKLKPVDYEYREEVHWATHKPCLGRGSFGEVHRMEDKQ
TGFQCAVKKVRVEMFRAEELMSCAGLTSPRIVPLYGAVKEGPWVNIFMELLEGGSLGQLI
KQTGCLPEDRALYYLGQALEGLEYLHTRRILHGDVKADNVLLSNDGSRAALCDFGHAVCL
RPDGLGNSLLTGDYIPGTETHMAPEVVMGKPCDAKVDVWSSCCMMLHMLNGCHPWTQYFR
GPLCLKIASEPPPVREIPPSCAPLTAQAIEEGLRKEPDHRASAIELGGKVSLALQHVGGL
KSPWRGEYKEPRHLPSHQAHPPPSPAHSHQILQAQPRELSPGTPGTQPAEDKTGGAPKLQ
PPLPPDPPERNKCPSLNWAKEESGMWEPLPLSSLDPAPTKNPSSPERKATFPEQELQQLE
IELFLNSLSQPFSLEEQEQILSCLSIDSLSLSDDSEKNPSKASQSSRDTLSSGVHSWGSQ
AEACSSSWNMVLARGRPTDTPSYFNGVKVQIQSLNGEHLHIREFHRVKVGDIATGISSQI
PAAAFSLVTKDGQPVRYDMEVPDSGIDLQCTLAPDGSFAWSWRVKHGQLENRP
NT seq 2862 nt   +upstreamnt  +downstreamnt
atggcagtgatggaaatggcctgcccaggcgctcctggctcgacagtcgggcagcagaag
gagctcgccaaagccaagaagacacaggcaatgggcaagaagcaaagctccgtccacaag
cttgaggccgtggagaagagccccgtgttctgcgggaagtgggagatcctgaacgacgtg
attaccaaaggcacagccaaggaaggctctgagggagggccagccgccatctccatcatt
gcccaggctgaatgtgagaatagccaggagttcagccccaccttttcggaacggattttc
atcgctgggtcgaaacagtacagccagtctgagagccttgaccaaatccccaacaatgtg
gcccatgcaactgagggcaaaatggcccgcgtgtgttggaaggggaagcgtcgcagcaaa
gcccggaagaaacgcaagaagaagagctcaaagtcactggctcaggcaggagtggccttg
gccagacccctccccagaacccctgagcaggagagctgcacggtccctgtgcaggaggac
gagtccccacttggcaccccatatattagaagtgccccccagttcaccaatcctctgaag
gagccagaccttggccaactctgttttaagaaacttggggagggcctacggccagcactg
cctcgatcggaactccacaaactgatcagccccttgcaatgtctaaaccacgtgtggaaa
ctccactacccccaggatgcaggccccttgccccagcttgctcaccccttcccctacaac
agactcccccatcccttcccattccaccctctccagccctggaaacctcatcccctagag
tccttcctgggcaaattggcctgtgtagatagccatcagcccctgcctggccctcccctg
ggcaaactagcctgtatagacagtcagaagcccctgcctggcccacccctggagcccagc
tgcccacttcgtggcactcatgagaagttttctgtggaggagtacctggtgcatgctctg
caaggcagcgtaagctccggccaggcccacagcctggccagcctggccaagacctggtcg
gcaggaggctccaggccccagaagcccagccccaaaactgaggacagcgagggagtcctg
cttactgagaaactgaagccggtggattatgagtaccgggaggaggtccactgggccacg
cacaagccctgcctgggtagaggctccttcggagaggtacacaggatggaggacaagcag
actggcttccagtgtgctgtcaaaaaggtgcgagtcgaaatgtttcgggcagaggagttg
atgtcatgtgcaggactgacttcacccagaatcgtccctttgtatggagcagtgaaggaa
ggtccttgggtcaatatcttcatggaactgctagaaggtggctcgctgggccagctcata
aagcagacgggctgtctgccggaggaccgagccctgtactacctgggccaggccctggaa
gggctggaatacctccatacccgaaggattctacacggcgatgtcaaagctgacaatgtg
ctcctgtccaatgatgggagccgtgcagccctctgtgactttggccatgctgtgtgcctt
cgacctgatggcctggggaattccttgctcacaggggactacatccctggcacagagacc
cacatggctcctgaggtagtgatgggcaagccctgtgatgccaaggtggacgtgtggagc
agctgctgcatgatgctgcatatgctcaacggctgccacccttggacccagtacttccga
ggaccgctttgcctcaagattgccagcgagcctccgcctgtgagggagatcccaccttcc
tgcgcccctctcacagcccaggccattgaggaggggctgaggaaagagcctgaccaccga
gcatctgcaatagagcttggggggaaggtcagcctggcgctgcagcatgtgggaggtctg
aagagcccttggaggggagagtataaagagccaagacatctgccgtcacaccaagcccat
ccaccgccaagcccggcccactctcaccagatccttcaagcccagccgagggagctctca
ccagggaccccagggacccagccagctgaggacaaaacaggcggggcccccaagctccaa
cctcctctacctccagatcccccagagcgaaacaagtgtccaagcctgaactgggccaag
gaggagtctgggatgtgggaacccttgcctctgtcttccctggacccagcccccaccaaa
aaccccagctcaccagagcggaaggcgaccttcccggagcaggaactgcagcagctggaa
atagaattatttctgaatagtctgtcccagccattttctctggaggaacaggagcaaatt
ctctcgtgcctcagcatcgacagcctctccctgtcagatgacagtgaaaagaacccgtca
aaggcctctcagagctcacgggacaccctgagttctggcgtacactcatggggcagccag
gccgaggcttgcagctccagctggaacatggtgctggcccggggacggcccactgacacg
ccaagctatttcaacggtgtgaaagtccaaatacagtctctcaatggtgaacacctgcac
atccgggagttccaccgagtcaaggtgggagacatcgcaactggcatcagcagccagatc
ccagctgcagccttcagcttggtgaccaaggacgggcagcctgtgcgctacgacatggag
gtgccagactcgggcatcgacctgcagtgtaccctggccccagatggcagcttcgcctgg
agctggagggtcaagcatggccagctggagaacaggccctaa

DBGET integrated database retrieval system