KEGG   Miniopterus natalensis (Natal long-fingered bat): 107531277
Entry
107531277         CDS       T05883                                 
Symbol
RBX1
Name
(RefSeq) E3 ubiquitin-protein ligase RBX1
  KO
K03868  E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32]
Organism
mna  Miniopterus natalensis (Natal long-fingered bat)
Pathway
mna03420  Nucleotide excision repair
mna04066  HIF-1 signaling pathway
mna04110  Cell cycle
mna04114  Oocyte meiosis
mna04120  Ubiquitin mediated proteolysis
mna04141  Protein processing in endoplasmic reticulum
mna04310  Wnt signaling pathway
mna04350  TGF-beta signaling pathway
mna04710  Circadian rhythm
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
mna05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107531277 (RBX1)
   04120 Ubiquitin mediated proteolysis
    107531277 (RBX1)
  09124 Replication and repair
   03420 Nucleotide excision repair
    107531277 (RBX1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107531277 (RBX1)
   04350 TGF-beta signaling pathway
    107531277 (RBX1)
   04066 HIF-1 signaling pathway
    107531277 (RBX1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107531277 (RBX1)
   04114 Oocyte meiosis
    107531277 (RBX1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    107531277 (RBX1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107531277 (RBX1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    107531277 (RBX1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107531277 (RBX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mna04121]
    107531277 (RBX1)
   03400 DNA repair and recombination proteins [BR:mna03400]
    107531277 (RBX1)
Enzymes [BR:mna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.32  cullin-RING-type E3 NEDD8 transferase
     107531277 (RBX1)
Ubiquitin system [BR:mna04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   107531277 (RBX1)
  Multi subunit Ring-finger type E3
   SCF complex
    Ring finger protein
     107531277 (RBX1)
   Cul2 complex
     107531277 (RBX1)
   Cul3 complex
     107531277 (RBX1)
   Cul4 complex
     107531277 (RBX1)
   Cul7 complex
     107531277 (RBX1)
   Cul9 complex
     107531277 (RBX1)
DNA repair and recombination proteins [BR:mna03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      107531277 (RBX1)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      107531277 (RBX1)
SSDB
Motif
Pfam: zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3
Other DBs
NCBI-GeneID: 107531277
NCBI-ProteinID: XP_016060804
LinkDB
Position
Unknown
AA seq 108 aa
MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ
ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
NT seq 327 nt   +upstreamnt  +downstreamnt
atggcggcagcaatggatgtggataccccgagcggcaccaacagcggcgcgggcaagaaa
cgctttgaagtgaaaaagtggaatgcagtagccctgtgggcctgggatattgtggttgat
aactgtgccatctgcaggaaccacattatggatctttgcatagaatgccaggctaaccag
gcgtctgccacttctgaagagtgcaccgtcgcgtggggagtctgtaatcatgcttttcac
ttccactgcatctctcgctggctcaaaacacggcaggtgtgtccactggacaacagagag
tgggaattccaaaagtatgggcactag

DBGET integrated database retrieval system