KEGG   Miniopterus natalensis: 107531542
Entry
107531542         CDS       T05883                                 

Gene name
CASP9
Definition
(RefSeq) caspase-9
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
mna  Miniopterus natalensis
Pathway
mna01524  Platinum drug resistance
mna04115  p53 signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04210  Apoptosis
mna04215  Apoptosis - multiple species
mna04370  VEGF signaling pathway
mna04919  Thyroid hormone signaling pathway
mna05010  Alzheimer disease
mna05012  Parkinson disease
mna05014  Amyotrophic lateral sclerosis
mna05016  Huntington disease
mna05020  Prion disease
mna05022  Pathways of neurodegeneration - multiple diseases
mna05134  Legionellosis
mna05145  Toxoplasmosis
mna05152  Tuberculosis
mna05160  Hepatitis C
mna05161  Hepatitis B
mna05162  Measles
mna05163  Human cytomegalovirus infection
mna05164  Influenza A
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05168  Herpes simplex virus 1 infection
mna05169  Epstein-Barr virus infection
mna05170  Human immunodeficiency virus 1 infection
mna05200  Pathways in cancer
mna05210  Colorectal cancer
mna05212  Pancreatic cancer
mna05213  Endometrial cancer
mna05215  Prostate cancer
mna05222  Small cell lung cancer
mna05223  Non-small cell lung cancer
mna05416  Viral myocarditis
mna05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    107531542 (CASP9)
   04151 PI3K-Akt signaling pathway
    107531542 (CASP9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107531542 (CASP9)
   04215 Apoptosis - multiple species
    107531542 (CASP9)
   04115 p53 signaling pathway
    107531542 (CASP9)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    107531542 (CASP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107531542 (CASP9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107531542 (CASP9)
   05212 Pancreatic cancer
    107531542 (CASP9)
   05215 Prostate cancer
    107531542 (CASP9)
   05213 Endometrial cancer
    107531542 (CASP9)
   05222 Small cell lung cancer
    107531542 (CASP9)
   05223 Non-small cell lung cancer
    107531542 (CASP9)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107531542 (CASP9)
   05161 Hepatitis B
    107531542 (CASP9)
   05160 Hepatitis C
    107531542 (CASP9)
   05164 Influenza A
    107531542 (CASP9)
   05162 Measles
    107531542 (CASP9)
   05168 Herpes simplex virus 1 infection
    107531542 (CASP9)
   05163 Human cytomegalovirus infection
    107531542 (CASP9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107531542 (CASP9)
   05169 Epstein-Barr virus infection
    107531542 (CASP9)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    107531542 (CASP9)
   05152 Tuberculosis
    107531542 (CASP9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107531542 (CASP9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107531542 (CASP9)
   05012 Parkinson disease
    107531542 (CASP9)
   05014 Amyotrophic lateral sclerosis
    107531542 (CASP9)
   05016 Huntington disease
    107531542 (CASP9)
   05020 Prion disease
    107531542 (CASP9)
   05022 Pathways of neurodegeneration - multiple diseases
    107531542 (CASP9)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    107531542 (CASP9)
   05416 Viral myocarditis
    107531542 (CASP9)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107531542 (CASP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mna01009]
    107531542 (CASP9)
   01002 Peptidases and inhibitors [BR:mna01002]
    107531542 (CASP9)
Enzymes [BR:mna01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     107531542 (CASP9)
Protein phosphatases and associated proteins [BR:mna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107531542 (CASP9)
Peptidases and inhibitors [BR:mna01002]
 Cysteine peptidases
  Family C14: caspase family
   107531542 (CASP9)
SSDB
Motif
Pfam: Peptidase_C14 CARD
Other DBs
NCBI-GeneID: 107531542
NCBI-ProteinID: XP_016061126
LinkDB
Position
Unknown
AA seq 404 aa
MSLSHLTLRGERAGSGSRRDQARQLVIDLETRGSQALPLFISCLEETGQHSLASLLRTSS
QAARRDLEAIRPLDLKPVVVRPEELRVAKQDPPKLTPGTLTPVVLRPEVPRPGVPRPVDI
GPGGSGDVGAQGRSRGNADLAYVLNADPCGHCIIINNVTFCLTSGLSTRKGSDVDCERLQ
RRFHLLHFMVEVKRDLTAKHMVQALAELAQQDHSALDCCVVVILSHGCQASHLQFPGAVY
GTDGCPVSVERIVNIFNGTGCPSLGGKPKLFFIQACGGEQKDHGFAVVSSSPQDGAPGRN
PESDAAPFQDHPGSYDQPDAVSSLPTPSDIFVSYSTFPGFVSWRDPRRGSWYIETLDGVF
EQWAHSEDLQSLLLRVANAVSEKGVYKQIPGCFNFLRKKLFFKT
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgtctttgtctcacttgaccctgcgaggtgagagggcaggctctgggtctcggcgtgat
caggccaggcagctcgtcatagacctggagactcgcgggagccaggcccttcctttgttc
atctcctgcctggaggaaacaggccagcacagcctggcttcactcctgagaacaagtagc
caagcagcaaggcgggacctggaggccatcagacccctggacctcaaacccgtggtggtc
agaccagaggagctgagagtagcgaagcaggacccaccgaagctgaccccaggcacactc
actccagtggtgttgaggccagaggttcccagaccaggcgtgcccaggccagtggacatt
ggtcctggaggatccggtgatgtcggtgctcaggggagatcgaggggaaacgctgatttg
gcgtatgtcctgaacgcggacccctgtggccactgcatcattatcaacaacgtgaccttc
tgccttacgtcggggctcagcacccgcaagggctccgacgtggactgcgagaggctgcag
agacgcttccacctgctacacttcatggtggaggtgaagcgcgacctgactgccaagcat
atggtccaggctctggcagagctggcgcagcaggaccacagcgccctggactgctgtgtg
gtggtcatcctctctcacggttgtcaggccagccacctccagttcccgggggccgtctac
ggcacagatgggtgtcccgtgtccgtggagagaatcgtgaacatcttcaacggaaccggc
tgccccagcttgggagggaagcccaaactcttcttcatccaggcctgcggtggagagcag
aaagaccacgggtttgcggtggtctccagctcccctcaggacggggcccccggcaggaac
cccgagtcagacgctgccccgttccaggaccacccaggcagctacgaccagccggatgcc
gtgtccagcctgcccacgccaagcgacatctttgtgtcctactccaccttcccaggtttt
gtctcctggagggaccccaggaggggctcttggtacatcgagaccctggatggcgtcttt
gagcagtgggctcactctgaagacctgcagagcctcctgctcagggtcgctaatgccgtc
tcggagaaaggggtttacaaacagattcctgggtgttttaatttcctccggaaaaaactc
ttctttaaaacttaa

DBGET integrated database retrieval system