KEGG   Miniopterus natalensis: 107539147
Entry
107539147         CDS       T05883                                 

Symbol
MCL1
Name
(RefSeq) induced myeloid leukemia cell differentiation protein Mcl-1
  KO
K02539  myeloid leukemia cell differntiation protein MCL-1
Organism
mna  Miniopterus natalensis
Pathway
mna04151  PI3K-Akt signaling pathway
mna04210  Apoptosis
mna04630  JAK-STAT signaling pathway
mna05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107539147 (MCL1)
   04151 PI3K-Akt signaling pathway
    107539147 (MCL1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107539147 (MCL1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    107539147 (MCL1)
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3
Other DBs
NCBI-GeneID: 107539147
NCBI-ProteinID: XP_016071058
LinkDB
Position
Unknown
AA seq 354 aa
MFGLKRNAVIGLNLYCGGTKLGGGSGADGGAASPSEEQLLPAGKEATARREAEGGEAATV
IGGSPSGRPPATLALDARRVARPSPIGAEGLDVTETPTRWLFAPARHTSPLEEMEVPAAD
AIMSPEEELDGYEPEPLGKRPAVLPLLELVEEASNGLGASGSLPSTPPPAEEEEEDELFR
QSLEIISRYLREQATGAKDAKPMAGSAASSRKALETLRRVGDGVQRNHETAFQGMLRKLD
IKNEDDIKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSIKQEGCIEPLAESITD
VLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgtttggcctcaaaagaaacgcggtaatcggactcaacctctactgcggagggaccaag
ttggggggcggcagcggggccgacggcggcgccgcctccccttcagaagaacagcttctg
cctgcgggaaaggaggccacggcccggcgagaggcggagggaggggaagcggccacggtg
attggcggaagccccagcgggagacccccggccactctcgcgctggatgccaggagggtc
gcgcggccctcgcccattggcgccgagggcctcgacgtcaccgagacccccacgaggtgg
cttttcgcgccagcccgccacacgtccccgcttgaagagatggaagtcccggcagccgac
gccatcatgtctcccgaagaggagctggacggttacgagccggagcctctcgggaagcgg
ccggctgtcctgcccttgctggagctggtcgaggaggccagtaatggcctcggtgcgagt
ggctctctgccctcgacgccgcccccagcagaggaggaggaggaggacgagttgttccgg
cagtcgctggagattatctctcggtaccttagggagcaggcgaccggcgccaaggacgcg
aagccaatggccgggtcagcggcctccagccggaaggcgttagagacccttcggcgggtc
ggggacggtgtgcagcgtaaccacgagacagccttccaaggtatgctgcggaaactggac
atcaaaaacgaagacgacatcaaatctttgtctagggtaatggttcatgtttttagtgac
ggagtaacaaactggggcaggattgtgactctcatatcttttggtgcctttgtggccaaa
cacttgaagagtataaagcaagaaggctgcattgaaccattagcagaaagcatcacagat
gttctcgtaaggacaaaacgagactggctggtcaaacaaagaggctgggatgggtttgtg
gagttcttccacgtagaggacctagaaggcggcatcagaaatgtgctgctggcttttgca
ggtgttgctggagtaggagctggtttggcatatttaataagatag

DBGET integrated database retrieval system