KEGG   Miniopterus natalensis: 107539351
Entry
107539351         CDS       T05883                                 

Gene name
SNRPB
Definition
(RefSeq) small nuclear ribonucleoprotein-associated proteins B and B' isoform X1
  KO
K11086  small nuclear ribonucleoprotein B and B'
Organism
mna  Miniopterus natalensis
Pathway
mna03040  Spliceosome
mna05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107539351 (SNRPB)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107539351 (SNRPB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mna03041]
    107539351 (SNRPB)
   03032 DNA replication proteins [BR:mna03032]
    107539351 (SNRPB)
Spliceosome [BR:mna03041]
 Complex A
  U1 snRNP components
   Sm proteins
    107539351 (SNRPB)
  U2 snRNP components
    107539351 (SNRPB)
 Complex B
  U1 snRNP components
    107539351 (SNRPB)
  U4/U6.U5 tri-snRNP components
    107539351 (SNRPB)
 Complex C
  U2 snRNP components
    107539351 (SNRPB)
DNA replication proteins [BR:mna03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (fungi)
    Sm core complex
     107539351 (SNRPB)
SSDB
Motif
Pfam: LSM
Other DBs
NCBI-GeneID: 107539351
NCBI-ProteinID: XP_016071301
LinkDB
Position
Unknown
AA seq 240 aa
MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAE
REEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPM
PQAPAGLAGPVRGVGGPSQQVMTPQARGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMG
RGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGPPPPGMHPPRP
NT seq 723 nt   +upstreamnt  +downstreamnt
atgactgtgggcaagagcagcaagatgctgcagcacatcgactacaggatgaggtgcatc
ctgcaagatggtcgtatcttcattggcaccttcaaggctttcgacaagcatatgaatttg
atcctatgtgattgtgatgaattcaggaagatcaagccaaagaactcaaaacaagcagag
agagaagagaagcgagtccttggtctggtgctgcttcgaggggagaacctggtctccatg
acagtagagggaccccctcccaaagatactggcattgcccgagtgccacttgctggagct
gctggaggcccagggattgggagggctgctggcagaggaatcccagctggtgttcccatg
ccccaggcccctgcaggacttgctgggccagttcgtggggttggtggaccatcacaacag
gtgatgaccccacaagcaagaggcactgttgcagctgctgcagctgctgccacagccagt
attgcaggggccccaactcagtacccacccggccgtgggggccctcccccacctatgggc
cgaggggcaccccctccaggcatgatgggcccacctcctggtatgaggcctcccatgggt
cccccaatggggatcccccctggacgaggaactccaatgggcatgccccctccagggatg
cgcccccctccgccaggaatgcgagggccccctcccccaggaatgcacccaccaaggccc
tag

DBGET integrated database retrieval system