KEGG   Miniopterus natalensis: 107539933
Entry
107539933         CDS       T05883                                 

Gene name
CD40LG
Definition
(RefSeq) CD40 ligand
  KO
K03161  tumor necrosis factor ligand superfamily member 5
Organism
mna  Miniopterus natalensis
Pathway
mna04060  Cytokine-cytokine receptor interaction
mna04064  NF-kappa B signaling pathway
mna04514  Cell adhesion molecules
mna04660  T cell receptor signaling pathway
mna04672  Intestinal immune network for IgA production
mna05144  Malaria
mna05145  Toxoplasmosis
mna05310  Asthma
mna05320  Autoimmune thyroid disease
mna05322  Systemic lupus erythematosus
mna05330  Allograft rejection
mna05340  Primary immunodeficiency
mna05416  Viral myocarditis
mna05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    107539933 (CD40LG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107539933 (CD40LG)
   04514 Cell adhesion molecules
    107539933 (CD40LG)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    107539933 (CD40LG)
   04672 Intestinal immune network for IgA production
    107539933 (CD40LG)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    107539933 (CD40LG)
   05145 Toxoplasmosis
    107539933 (CD40LG)
  09163 Immune disease
   05310 Asthma
    107539933 (CD40LG)
   05322 Systemic lupus erythematosus
    107539933 (CD40LG)
   05320 Autoimmune thyroid disease
    107539933 (CD40LG)
   05330 Allograft rejection
    107539933 (CD40LG)
   05340 Primary immunodeficiency
    107539933 (CD40LG)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    107539933 (CD40LG)
   05416 Viral myocarditis
    107539933 (CD40LG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mna04052]
    107539933 (CD40LG)
   04090 CD molecules [BR:mna04090]
    107539933 (CD40LG)
Cytokines and growth factors [BR:mna04052]
 Cytokines
  Tumor necrosis fators
   107539933 (CD40LG)
CD molecules [BR:mna04090]
 Proteins
  107539933 (CD40LG)
SSDB
Motif
Pfam: TNF DUF5677
Other DBs
NCBI-GeneID: 107539933
NCBI-ProteinID: XP_016072026
LinkDB
Position
Unknown
AA seq 260 aa
MIETYSQPSPRSVTSGPPISMKIFMYLLTVFLITQMIGSALFAVYLHRRLDKIEDERNLH
EDFVFMKMIQRCNKGERSLSLLNCEEIRSQFEAFVKDIMGNEVKEKEKNFQQQKGDQDPQ
IAAHVISEASGKTASVLQWAQKGYYTMSNNLVTLENGKQLAVKRQGLYYIYAQVTFCSNR
EASSQAPFIASLCLRSTSGSERILLRAANTHSSSKPCGQQSIHLGGVFELQSGASVFVNV
TDPSQVSHGTGFTSFGLLKL
NT seq 783 nt   +upstreamnt  +downstreamnt
atgatcgaaacatacagccaaccttctccccgatctgtgaccagtggaccacccatcagt
atgaaaatttttatgtatttacttactgtttttcttatcacccagatgattgggtccgca
ctttttgctgtgtatcttcacagaagattggacaagatagaagatgaaaggaatcttcat
gaagattttgtgttcatgaaaatgatacagaggtgcaacaaaggagagaggtccttatcc
ttactgaactgtgaggaaattagaagccagtttgaagccttcgtcaaggacataatggga
aatgaagtgaaggagaaagaaaaaaactttcaacagcaaaaaggtgatcaggatcctcaa
attgcagcacatgtcataagtgaggccagtggtaaaacagcatctgttctacagtgggcc
caaaaaggatactacaccatgagcaacaacttggtaaccctcgaaaatgggaaacagctt
gccgttaaaagacaaggactctattatatctatgcccaagtcaccttctgttctaatcgg
gaagcttcgagtcaagctccatttatagccagcctctgcctgaggtccacgagtggatct
gagagaatcttacttagagcggcaaatacccacagttcctccaaaccctgcgggcaacaa
tccattcacttgggaggagtatttgaattgcaatcaggtgcttcggtgtttgtcaatgtg
actgatccaagccaagtgagccatgggaccggcttcacatcttttggcttactcaaactc
tga

DBGET integrated database retrieval system