Merops nubicus (carmine bee-eater): 103776824 Help Entry 103776824         CDS       T08417                                  Symbol IL6 Name (RefSeq) interleukin-6   KO K05405   interleukin 6 Organism mnb  Merops nubicus (carmine bee-eater) Pathway mnb04060   Cytokine-cytokine receptor interaction mnb04068   FoxO signaling pathway mnb04218   Cellular senescence mnb04620   Toll-like receptor signaling pathway mnb04621   NOD-like receptor signaling pathway mnb04623   Cytosolic DNA-sensing pathway mnb04625   C-type lectin receptor signaling pathway mnb04672   Intestinal immune network for IgA production mnb05132   Salmonella infection mnb05164   Influenza A mnb05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:mnb00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     103776824 (IL6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103776824 (IL6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     103776824 (IL6)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103776824 (IL6)    04621 NOD-like receptor signaling pathway     103776824 (IL6)    04623 Cytosolic DNA-sensing pathway     103776824 (IL6)    04625 C-type lectin receptor signaling pathway     103776824 (IL6)    04672 Intestinal immune network for IgA production     103776824 (IL6)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     103776824 (IL6)    05168 Herpes simplex virus 1 infection     103776824 (IL6)   09171 Infectious disease: bacterial    05132 Salmonella infection     103776824 (IL6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mnb04052]     103776824 (IL6) Cytokines and neuropeptides [BR:mnb04052]  Cytokines   Interleukins    103776824 (IL6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL6 IL23 GCSF Not3 Motif Other DBs NCBI-GeneID:  103776824 NCBI-ProteinID:  XP_008942599 LinkDB All DBs Position Unknown AA seq 152 aa AA seqDB search PQMCEKFTVCENSMEMLVQNNLNLPKVTEEDGCLLAGFNEDKCLKKISSGLYTFQTYLEY VQETFTSEKQKVESLCYSTEHLAHTIRQMVINPDEVIIPDSATQESLRAKLKSNKTWIEK ITTHLILRDFTSFMEKTVRAVRYLKNTRSSSV NT seq 459 nt NT seq  +upstreamnt  +downstreamnt ccccagatgtgcgagaagtttaccgtctgtgagaacagcatggaaatgctcgtccagaac aacctcaacctccccaaagtgacggaggaagatgggtgcctgctcgccggcttcaacgag gataaatgcttgaagaaaatctccagcgggctttatacgtttcagacataccttgaatac gtacaagaaactttcactagtgaaaagcaaaaggtcgaatcgctgtgctacagtacagag cacctggcacacaccataaggcagatggtgatcaatcccgatgaagtgatcatcccagac tcagctacccaggaatccctccgagcaaagctgaagtccaataagacctggatagagaag atcaccacccacctcatcctccgagactttacttcgtttatggagaaaaccgtgagggcc gttcgttatttgaaaaataccaggagttccagtgtctga

DBGET integrated database retrieval system