KEGG   Merops nubicus (carmine bee-eater): 103781356
Entry
103781356         CDS       T08417                                 
Symbol
GNA13
Name
(RefSeq) LOW QUALITY PROTEIN: guanine nucleotide-binding protein subunit alpha-13
  KO
K04639  guanine nucleotide-binding protein subunit alpha-13
Organism
mnb  Merops nubicus (carmine bee-eater)
Pathway
mnb04081  Hormone signaling
mnb04270  Vascular smooth muscle contraction
mnb04371  Apelin signaling pathway
mnb04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mnb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103781356 (GNA13)
  09133 Signaling molecules and interaction
   04081 Hormone signaling
    103781356 (GNA13)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103781356 (GNA13)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103781356 (GNA13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mnb04147]
    103781356 (GNA13)
   04031 GTP-binding proteins [BR:mnb04031]
    103781356 (GNA13)
Exosome [BR:mnb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103781356 (GNA13)
  Exosomal proteins of colorectal cancer cells
   103781356 (GNA13)
GTP-binding proteins [BR:mnb04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    103781356 (GNA13)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA MafB
Other DBs
NCBI-GeneID: 103781356
NCBI-ProteinID: XP_008947317
LinkDB
Position
Unknown
AA seq 220 aa
HDTYLNNHLLCFXGESVKYFLDNLDKLGEQDYLPSQQDILLARRPTKGIHEYDFEIKNVP
FKMVDVGGQRSERKRWFECFDSVTSILFLVSSSEFDQVLMEDRQTNRLTESLNIFETIVN
NRVFSNVSIILFLNKTDLLEEKVQKVSIKDYFPEFEGNPHCLTDVQKFLVDCFRTKRRDQ
QQKPLYHHFTTAINTENIRLVFRDVKDTILHDNLKQLMLQ
NT seq 663 nt   +upstreamnt  +downstreamnt
catgacacttatttaaataaccatcttctttgtttttagggggaatctgtaaagtatttc
ttggacaacttggataaacttggagaacaagattatcttccctcgcagcaagacatcctg
ctggcacgaaggcccacgaaagggatccacgagtacgacttcgagatcaagaatgttccc
ttcaaaatggtggatgtgggtgggcagaggtcggaacggaaacgctggttcgagtgcttc
gacagcgtcacgtccatcctcttcctcgtgtcctccagtgaatttgaccaagtgctgatg
gaggaccggcagacgaaccgcctcacggagtccctgaacatttttgaaaccatagtcaat
aaccgggtgttcagcaacgtctccatcatcctcttcttaaacaagacggacttgctcgag
gaaaaagtacaaaaagtcagcatcaaagactattttccagagttcgaagggaatccccac
tgcttaacagatgtccaaaaattcctggtggattgttttcgtactaaacgccgggaccag
cagcagaagcccctctaccaccacttcaccactgccattaacacagagaacatccggcta
gtcttccgtgacgttaaggataccatcctccacgacaacctcaagcagctgatgttacag
tga

DBGET integrated database retrieval system