Macaca nemestrina (pig-tailed macaque): 105465315 Help Entry 105465315         CDS       T08765                                  Symbol POLE4 Name (RefSeq) DNA polymerase epsilon subunit 4   KO K03506   DNA polymerase epsilon subunit 4 [EC:2.7.7.7] Organism mni  Macaca nemestrina (pig-tailed macaque) Pathway mni03030   DNA replication mni03410   Base excision repair mni03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:mni00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     105465315 (POLE4)    03410 Base excision repair     105465315 (POLE4)    03420 Nucleotide excision repair     105465315 (POLE4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:mni03032]     105465315 (POLE4)    03400 DNA repair and recombination proteins [BR:mni03400]     105465315 (POLE4) Enzymes [BR:mni01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      105465315 (POLE4) DNA replication proteins [BR:mni03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     105465315 (POLE4) DNA repair and recombination proteins [BR:mni03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       105465315 (POLE4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CBFD_NFYB_HMF Histone TAF CENP-T_C Motif Other DBs NCBI-GeneID:  105465315 NCBI-ProteinID:  XP_011712021 Ensembl:  ENSMNEG00000014492 UniProt:  A0A2K6AVF7 LinkDB All DBs Position Unknown AA seq 117 aa AA seqDB search MAAAATAGSGTPREEEGPAGEAAALQPQAPTSVPGARLSRLPLARVKALVKADPDVTLAG QEAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGTLD NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggcagcggcggcgacggcaggaagcgggacaccccgagaggaggagggacctgctggg gaggcagcggccttgcagccccaagccccaacgagtgtgcctggggctcgtctctcgagg ttgcctctggcgcgagtgaaggccttggtgaaggcggaccccgacgtgacgctagccgga caggaagccatcttcattctggcacgagccgcggaactgtttgtggagaccattgcaaaa gatgcctactgttgtgctcagcagggaaaaaggaaaactcttcagaggagagacttggat aatgcaatagaagctgtggatgaatttgcttttctggaaggtactttggattga

DBGET integrated database retrieval system