Macaca nemestrina (pig-tailed macaque): 105465886 Help Entry 105465886         CDS       T08765                                  Symbol IFNB1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism mni  Macaca nemestrina (pig-tailed macaque) Pathway mni04060   Cytokine-cytokine receptor interaction mni04151   PI3K-Akt signaling pathway mni04217   Necroptosis mni04380   Osteoclast differentiation mni04620   Toll-like receptor signaling pathway mni04621   NOD-like receptor signaling pathway mni04622   RIG-I-like receptor signaling pathway mni04623   Cytosolic DNA-sensing pathway mni04630   JAK-STAT signaling pathway mni04650   Natural killer cell mediated cytotoxicity mni04668   TNF signaling pathway mni04936   Alcoholic liver disease mni05135   Yersinia infection mni05142   Chagas disease mni05152   Tuberculosis mni05160   Hepatitis C mni05161   Hepatitis B mni05162   Measles mni05163   Human cytomegalovirus infection mni05164   Influenza A mni05165   Human papillomavirus infection mni05167   Kaposi sarcoma-associated herpesvirus infection mni05168   Herpes simplex virus 1 infection mni05169   Epstein-Barr virus infection mni05170   Human immunodeficiency virus 1 infection mni05171   Coronavirus disease - COVID-19 mni05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mni00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     105465886 (IFNB1)    04668 TNF signaling pathway     105465886 (IFNB1)    04151 PI3K-Akt signaling pathway     105465886 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105465886 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     105465886 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105465886 (IFNB1)    04621 NOD-like receptor signaling pathway     105465886 (IFNB1)    04622 RIG-I-like receptor signaling pathway     105465886 (IFNB1)    04623 Cytosolic DNA-sensing pathway     105465886 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     105465886 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     105465886 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     105465886 (IFNB1)    05161 Hepatitis B     105465886 (IFNB1)    05160 Hepatitis C     105465886 (IFNB1)    05171 Coronavirus disease - COVID-19     105465886 (IFNB1)    05164 Influenza A     105465886 (IFNB1)    05162 Measles     105465886 (IFNB1)    05168 Herpes simplex virus 1 infection     105465886 (IFNB1)    05163 Human cytomegalovirus infection     105465886 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     105465886 (IFNB1)    05169 Epstein-Barr virus infection     105465886 (IFNB1)    05165 Human papillomavirus infection     105465886 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     105465886 (IFNB1)    05152 Tuberculosis     105465886 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     105465886 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105465886 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     105465886 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mni04052]     105465886 (IFNB1) Cytokines and neuropeptides [BR:mni04052]  Cytokines   Interferons    105465886 (IFNB1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  105465886 NCBI-ProteinID:  XP_011712845 Ensembl:  ENSMNEG00000037943 UniProt:  A0A2K6CZ74 LinkDB All DBs Position Unknown AA seq 187 aa AA seqDB search MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRSSSFQCQKLLWQLNGRLEHCLKDRMNFD IPEEIKQPQQFQKEDAALTIYEMLQNIFAIFRQDLSSTGWNETIVENLLANVYHQIDHLK TILEEKLEKEDFTRGKFMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFFFINK LTGYLRN NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atgaccaacaagtgtctcctccaaattgctctcctgttgtgcttctccactacggctctt tccatgagctacaacttgcttggattcctacaaagaagcagcagttttcagtgtcagaag ctcctgtggcaattgaatggaaggcttgaacattgcctcaaggacaggatgaactttgac atccctgaggaaattaagcagccgcagcagttccagaaggaggacgctgcattgaccatc tatgagatgctccagaacatcttcgctattttcagacaagatttatctagcactggctgg aatgagactattgtggagaacctccttgctaatgtctatcatcagatagaccatctgaag acaatcctagaagaaaaactggagaaagaagatttcaccaggggaaaattcatgagcagt ttgcacctgaaaagatactatggaaggattctgcattacctgaaggccaaggagtacagt cactgtgcctggaccatagtcagagtggaaatcctcaggaactttttcttcattaacaaa cttacaggttacctccgaaactga

DBGET integrated database retrieval system