Macaca nemestrina (pig-tailed macaque): 105473705 Help Entry 105473705         CDS       T08765                                  Symbol MAX Name (RefSeq) protein max isoform X2   KO K04453   Max protein Organism mni  Macaca nemestrina (pig-tailed macaque) Pathway mni03083   Polycomb repressive complex mni04010   MAPK signaling pathway mni05200   Pathways in cancer mni05202   Transcriptional misregulation in cancer mni05222   Small cell lung cancer Brite KEGG Orthology (KO) [BR:mni00001]  09120 Genetic Information Processing   09126 Chromosome    03083 Polycomb repressive complex     105473705 (MAX)  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105473705 (MAX)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105473705 (MAX)    05202 Transcriptional misregulation in cancer     105473705 (MAX)   09162 Cancer: specific types    05222 Small cell lung cancer     105473705 (MAX)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mni03000]     105473705 (MAX)    03036 Chromosome and associated proteins [BR:mni03036]     105473705 (MAX) Transcription factors [BR:mni03000]  Eukaryotic type   Basic helix-loop-helix/leucine zipper (bHLH-ZIP)    Cell cycle controlling factors, Mad/Max     105473705 (MAX) Chromosome and associated proteins [BR:mni03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.6)      105473705 (MAX) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HLH JetA Filament bZIP_2 bHLH_INO4 SlyX bHLH_INO2 SLX9 GAGA_bind DUF7801 DUF4763 XhlA Csm1_N ATG16 Motif Other DBs NCBI-GeneID:  105473705 NCBI-ProteinID:  XP_011725955 Ensembl:  ENSMNEG00000031473 UniProt:  A0A2K6BTG7 LinkDB All DBs Position Unknown AA seq 160 aa AA seqDB search MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASR AQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDN SLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgagcgataacgatgacatcgaggtggagagcgacgaagagcaaccgaggtttcaatct gcggctgacaaacgggctcatcataatgcactggaacgaaaacgtagggaccacatcaaa gacagctttcacagtttgcgggactcagtcccatcactccaaggagagaaggcatcccgg gcccaaatcctagacaaagccacagagtatatccagtatatgcgaaggaaaaaccacaca caccagcaagatattgacgacctcaagcggcagaatgctcttctggagcagcaagtccgt gcactggagaaggcgaggtcaagtgcccaactgcagaccaactacccctcctcagacaac agcctctacaccaacgccaagggcagcaccatctctgccttcgatgggggctcggactcc agctcggagtctgagcctgaagagccccaaagcaggaagaagctccggatggaggccagc taa

DBGET integrated database retrieval system