Macaca nemestrina (pig-tailed macaque): 105477297 Help Entry 105477297         CDS       T08765                                  Symbol CXCL1 Name (RefSeq) growth-regulated alpha protein   KO K05505   C-X-C motif chemokine 1/2/3 Organism mni  Macaca nemestrina (pig-tailed macaque) Pathway mni04060   Cytokine-cytokine receptor interaction mni04061   Viral protein interaction with cytokine and cytokine receptor mni04062   Chemokine signaling pathway mni04064   NF-kappa B signaling pathway mni04621   NOD-like receptor signaling pathway mni04657   IL-17 signaling pathway mni04668   TNF signaling pathway mni04936   Alcoholic liver disease mni05134   Legionellosis mni05146   Amoebiasis mni05167   Kaposi sarcoma-associated herpesvirus infection mni05323   Rheumatoid arthritis mni05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mni00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     105477297 (CXCL1)    04668 TNF signaling pathway     105477297 (CXCL1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105477297 (CXCL1)    04061 Viral protein interaction with cytokine and cytokine receptor     105477297 (CXCL1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     105477297 (CXCL1)    04657 IL-17 signaling pathway     105477297 (CXCL1)    04062 Chemokine signaling pathway     105477297 (CXCL1)  09160 Human Diseases   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     105477297 (CXCL1)   09171 Infectious disease: bacterial    05134 Legionellosis     105477297 (CXCL1)   09174 Infectious disease: parasitic    05146 Amoebiasis     105477297 (CXCL1)   09163 Immune disease    05323 Rheumatoid arthritis     105477297 (CXCL1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105477297 (CXCL1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     105477297 (CXCL1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mni04052]     105477297 (CXCL1) Cytokines and neuropeptides [BR:mni04052]  Cytokines   Chemokines    105477297 (CXCL1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  105477297 NCBI-ProteinID:  XP_011732058 Ensembl:  ENSMNEG00000031974 UniProt:  A0A2K6BWQ9 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MARAALSAAPSNPRFLQVALLLLLLVATGRRAAGASVVTELRCQCLQTLQGIHPKNIQSV NVKAPGPHCAETEVIATLKNGQKACLNPASPMVQKIIKKMLNCDKSN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggcccgcgccgcgctctccgcagcccctagcaatccccggttcctgcaggtggcgctg ctgctcctgctcctggtggccaccggccggcgcgcagcaggagcgtccgtggtcactgaa ttgcgctgccagtgcttgcagaccctgcagggaattcaccccaagaatatccaaagtgtg aacgtgaaggccccaggaccccactgcgccgaaaccgaagtcatagccacactcaagaat gggcagaaagcttgtctcaaccccgcatcccccatggttcagaaaatcatcaaaaagatg ctgaactgtgacaaatccaactga

DBGET integrated database retrieval system