Macaca nemestrina (pig-tailed macaque): 105495778 Help Entry 105495778         CDS       T08765                                  Symbol FOS Name (RefSeq) proto-oncogene c-Fos   KO K04379   proto-oncogene protein c-fos Organism mni  Macaca nemestrina (pig-tailed macaque) Pathway mni01522   Endocrine resistance mni04010   MAPK signaling pathway mni04024   cAMP signaling pathway mni04210   Apoptosis mni04380   Osteoclast differentiation mni04620   Toll-like receptor signaling pathway mni04657   IL-17 signaling pathway mni04658   Th1 and Th2 cell differentiation mni04659   Th17 cell differentiation mni04660   T cell receptor signaling pathway mni04662   B cell receptor signaling pathway mni04668   TNF signaling pathway mni04713   Circadian entrainment mni04725   Cholinergic synapse mni04728   Dopaminergic synapse mni04915   Estrogen signaling pathway mni04917   Prolactin signaling pathway mni04921   Oxytocin signaling pathway mni04926   Relaxin signaling pathway mni04928   Parathyroid hormone synthesis, secretion and action mni04932   Non-alcoholic fatty liver disease mni04935   Growth hormone synthesis, secretion and action mni05031   Amphetamine addiction mni05132   Salmonella infection mni05133   Pertussis mni05135   Yersinia infection mni05140   Leishmaniasis mni05142   Chagas disease mni05161   Hepatitis B mni05162   Measles mni05166   Human T-cell leukemia virus 1 infection mni05167   Kaposi sarcoma-associated herpesvirus infection mni05170   Human immunodeficiency virus 1 infection mni05171   Coronavirus disease mni05200   Pathways in cancer mni05207   Chemical carcinogenesis - receptor activation mni05208   Chemical carcinogenesis - reactive oxygen species mni05210   Colorectal cancer mni05224   Breast cancer mni05231   Choline metabolism in cancer mni05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mni05323   Rheumatoid arthritis mni05417   Lipid and atherosclerosis mni05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mni00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105495778 (FOS)    04668 TNF signaling pathway     105495778 (FOS)    04024 cAMP signaling pathway     105495778 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     105495778 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105495778 (FOS)    04660 T cell receptor signaling pathway     105495778 (FOS)    04658 Th1 and Th2 cell differentiation     105495778 (FOS)    04659 Th17 cell differentiation     105495778 (FOS)    04657 IL-17 signaling pathway     105495778 (FOS)    04662 B cell receptor signaling pathway     105495778 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     105495778 (FOS)    04917 Prolactin signaling pathway     105495778 (FOS)    04921 Oxytocin signaling pathway     105495778 (FOS)    04926 Relaxin signaling pathway     105495778 (FOS)    04935 Growth hormone synthesis, secretion and action     105495778 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     105495778 (FOS)   09156 Nervous system    04725 Cholinergic synapse     105495778 (FOS)    04728 Dopaminergic synapse     105495778 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     105495778 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     105495778 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105495778 (FOS)    05207 Chemical carcinogenesis - receptor activation     105495778 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     105495778 (FOS)    05231 Choline metabolism in cancer     105495778 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     105495778 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     105495778 (FOS)    05224 Breast cancer     105495778 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     105495778 (FOS)    05170 Human immunodeficiency virus 1 infection     105495778 (FOS)    05161 Hepatitis B     105495778 (FOS)    05171 Coronavirus disease     105495778 (FOS)    05162 Measles     105495778 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     105495778 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     105495778 (FOS)    05135 Yersinia infection     105495778 (FOS)    05133 Pertussis     105495778 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     105495778 (FOS)    05142 Chagas disease     105495778 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     105495778 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     105495778 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105495778 (FOS)    05418 Fluid shear stress and atherosclerosis     105495778 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     105495778 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     105495778 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mni03000]     105495778 (FOS)    04131 Membrane trafficking [BR:mni04131]     105495778 (FOS) Transcription factors [BR:mni03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     105495778 (FOS) Membrane trafficking [BR:mni04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     105495778 (FOS) SSDB OrthologParalogGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 CCDC110 HALZ Macoilin Motif Other DBs NCBI-GeneID:  105495778 NCBI-ProteinID:  XP_011763817 Ensembl:  ENSMNEG00000031655 UniProt:  A0A2K6BUI2 LinkDB All DBs Position Unknown AA seq 380 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF IPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPTPSAGAYSRAGIVKTMTGSRA QSTGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEAATPESEEAFT LPLLNDPEPKPSVEPVKSISSMELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA ADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRK GSSSNEPSSDSLSSPTLLAL NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atgatgttctcgggcttcaacgcagactacgaggcgtcatcctcgcgctgcagcagcgcg tccccggccggggatagcctctcctactaccactcacccgccgattccttctccagcatg ggctcgcctgtcaacgcgcaggacttctgcacggacctggccgtctccagtgccaacttc attcccacggtcactgccatctcgaccagtccggacctgcagtggcttgtgcagcccgcc ctcgtctcctctgtggccccatcgcagaccagagcccctcaccccttcggagtccccact ccctccgctggggcttactccagggctggcattgtgaagaccatgacaggaagccgagcg cagagcactggcaggaggggtaaggtggaacagttatctccagaagaagaagagaaaagg agaatccgaagggaaaggaataagatggctgcagccaaatgccgcaaccggaggagggag ctgactgatacactccaagcggagacagaccaactagaagatgagaagtctgctttgcag accgagattgccaacctgctgaaggagaaggaaaaactagaattcatcctggcagctcac cgacctgcctgcaagatccctgatgacctgggctttccagaagagatgtctgtggcttcc cttgatctgactgggggcctgccagaggctgccaccccagagtctgaggaggccttcacc ctgcctctcctcaatgacccagagcccaagccctcagtggagcctgtcaagagcatcagc agcatggagctgaaggctgagccctttgatgacttcctgttcccagcatcatccaggccc agcggctctgagacagcccgctctgtaccagacatggacctatctgggtccttctatgca gcagactgggagcccctgcacagtggctccctggggatggggcccatggccacagagctg gagcccctgtgcactccggtggtcacctgtactcccagctgcactgcttacacgtcttcc ttcgtcttcacctaccctgaggctgactccttccccagctgcgcagctgcccaccgcaag ggcagcagcagcaatgagccctcctctgactcgctcagctcacccacgctgctggccctg tga

DBGET integrated database retrieval system