Mustela nigripes (black-footed ferret): 132022222 Help Entry 132022222         CDS       T09425                                  Name (RefSeq) transmembrane protein 258-like   KO K26502   transmembrane protein 258 Organism mnp  Mustela nigripes (black-footed ferret) Pathway mnp00510   N-Glycan biosynthesis mnp00513   Various types of N-glycan biosynthesis mnp04141   Protein processing in endoplasmic reticulum Module mnp_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:mnp00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     132022222    00513 Various types of N-glycan biosynthesis     132022222  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     132022222 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 Motif Other DBs NCBI-GeneID:  132022222 NCBI-ProteinID:  XP_059263532 LinkDB All DBs Position 7:13566240..13566461 Genome browser AA seq 73 aa AA seqDB search MEITALSRYISPVNPAVIPNLTMVLLALGMFFAPWFFIYEVTSTKYTQGICEELLISLVA SLLMCFGVLFLLL NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atggagatcacggccttgagcagatacatcagcccagtgaaccctgctgtcatccccaat ctgaccatggttctgttggcccttggtatgttctttgccccctggttcttcatttatgag gttacctccaccaagtacactcagggtatctgtgaagagctcctcatctccttggtggcc tcgctcctcatgtgctttggagtcctctttctgctgctttga

DBGET integrated database retrieval system