Mustela nigripes (black-footed ferret): 132025125 Help Entry 132025125         CDS       T09425                                  Symbol IFNB1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism mnp  Mustela nigripes (black-footed ferret) Pathway mnp04060   Cytokine-cytokine receptor interaction mnp04151   PI3K-Akt signaling pathway mnp04217   Necroptosis mnp04380   Osteoclast differentiation mnp04620   Toll-like receptor signaling pathway mnp04621   NOD-like receptor signaling pathway mnp04622   RIG-I-like receptor signaling pathway mnp04623   Cytosolic DNA-sensing pathway mnp04630   JAK-STAT signaling pathway mnp04650   Natural killer cell mediated cytotoxicity mnp04668   TNF signaling pathway mnp04936   Alcoholic liver disease mnp05135   Yersinia infection mnp05142   Chagas disease mnp05152   Tuberculosis mnp05160   Hepatitis C mnp05161   Hepatitis B mnp05162   Measles mnp05163   Human cytomegalovirus infection mnp05164   Influenza A mnp05165   Human papillomavirus infection mnp05167   Kaposi sarcoma-associated herpesvirus infection mnp05168   Herpes simplex virus 1 infection mnp05169   Epstein-Barr virus infection mnp05170   Human immunodeficiency virus 1 infection mnp05171   Coronavirus disease - COVID-19 mnp05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mnp00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     132025125 (IFNB1)    04668 TNF signaling pathway     132025125 (IFNB1)    04151 PI3K-Akt signaling pathway     132025125 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     132025125 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     132025125 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     132025125 (IFNB1)    04621 NOD-like receptor signaling pathway     132025125 (IFNB1)    04622 RIG-I-like receptor signaling pathway     132025125 (IFNB1)    04623 Cytosolic DNA-sensing pathway     132025125 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     132025125 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     132025125 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     132025125 (IFNB1)    05161 Hepatitis B     132025125 (IFNB1)    05160 Hepatitis C     132025125 (IFNB1)    05171 Coronavirus disease - COVID-19     132025125 (IFNB1)    05164 Influenza A     132025125 (IFNB1)    05162 Measles     132025125 (IFNB1)    05168 Herpes simplex virus 1 infection     132025125 (IFNB1)    05163 Human cytomegalovirus infection     132025125 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     132025125 (IFNB1)    05169 Epstein-Barr virus infection     132025125 (IFNB1)    05165 Human papillomavirus infection     132025125 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     132025125 (IFNB1)    05152 Tuberculosis     132025125 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     132025125 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     132025125 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     132025125 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mnp04052]     132025125 (IFNB1) Cytokines and neuropeptides [BR:mnp04052]  Cytokines   Interferons    132025125 (IFNB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  132025125 NCBI-ProteinID:  XP_059268275 LinkDB All DBs Position 9:47620521..47621081 Genome browser AA seq 186 aa AA seqDB search MTSRCILQTALLVYFSTTVLAMNYNLLRFQLSSSSVECQELLLQLNGTSKDCLKDRMNFK IPEEIQKSQKFQKEDIVLVTLEMFQKTSDIFRRNLSSTGWNESIVENLLATLHWQKEHLE EILEDIMQEENVTWDHRTLLHLKRYYLRIVRYLKAKEFSVCAWTIVQAEILRSFFFLDKL TDSLPN NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgaccagcaggtgtatcctccaaactgctctcctggtatatttctccaccacggttctt gccatgaactataacttacttcgattccaactaagcagcagcagtgtggagtgccaggag ctccttctacagttgaatggaacatctaaagattgcctcaaggacaggatgaacttcaag atccctgaggagatccagaaatcccagaagtttcagaaggaggacatcgtattggtcacc cttgagatgttccaaaagacttctgatattttcaggagaaatctctcaagcacgggatgg aatgagagcattgtcgagaacctccttgccacactccactggcagaaggaacatctggag gaaatcctggaggacatcatgcaggaggaaaacgtcacttgggaccacaggacccttctg cacctgaagagatattatctaaggattgtgcggtacctgaaagcgaaggagttcagcgtc tgtgcctggacaatagtgcaagcagaaatcctcaggagctttttcttccttgataaactt acagattctctccctaactga

DBGET integrated database retrieval system