Mustela nigripes (black-footed ferret): 132027869 Help Entry 132027869         CDS       T09425                                  Symbol IL4 Name (RefSeq) interleukin-4   KO K05430   interleukin 4 Organism mnp  Mustela nigripes (black-footed ferret) Pathway mnp04060   Cytokine-cytokine receptor interaction mnp04151   PI3K-Akt signaling pathway mnp04630   JAK-STAT signaling pathway mnp04640   Hematopoietic cell lineage mnp04657   IL-17 signaling pathway mnp04658   Th1 and Th2 cell differentiation mnp04659   Th17 cell differentiation mnp04660   T cell receptor signaling pathway mnp04664   Fc epsilon RI signaling pathway mnp04672   Intestinal immune network for IgA production mnp05140   Leishmaniasis mnp05200   Pathways in cancer mnp05310   Asthma mnp05320   Autoimmune thyroid disease mnp05321   Inflammatory bowel disease mnp05330   Allograft rejection Brite KEGG Orthology (KO) [BR:mnp00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     132027869 (IL4)    04151 PI3K-Akt signaling pathway     132027869 (IL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     132027869 (IL4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     132027869 (IL4)    04660 T cell receptor signaling pathway     132027869 (IL4)    04658 Th1 and Th2 cell differentiation     132027869 (IL4)    04659 Th17 cell differentiation     132027869 (IL4)    04657 IL-17 signaling pathway     132027869 (IL4)    04664 Fc epsilon RI signaling pathway     132027869 (IL4)    04672 Intestinal immune network for IgA production     132027869 (IL4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     132027869 (IL4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     132027869 (IL4)   09163 Immune disease    05310 Asthma     132027869 (IL4)    05320 Autoimmune thyroid disease     132027869 (IL4)    05321 Inflammatory bowel disease     132027869 (IL4)    05330 Allograft rejection     132027869 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mnp04052]     132027869 (IL4)    00536 Glycosaminoglycan binding proteins [BR:mnp00536]     132027869 (IL4) Cytokines and neuropeptides [BR:mnp04052]  Cytokines   Interleukins    132027869 (IL4) Glycosaminoglycan binding proteins [BR:mnp00536]  Heparan sulfate / Heparin   Cytokines    132027869 (IL4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL4 DUF4381 Motif Other DBs NCBI-GeneID:  132027869 NCBI-ProteinID:  XP_059272577 LinkDB All DBs Position 12:70393892..70401717 Genome browser AA seq 132 aa AA seqDB search MGLTSQLIPTLVCLLALTGTFIHGHNFSIAIKEIIKTLNILTARNDSCMELTVTEVFSAP KNTSEKEIFCRAATVLQQLSPHNCSNRLLRGLHRNLRNMANMTCSVNEVKKSTLKDFLER LKVIMQQKYYRH NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atgggtctcacctcccaactgattccaactctggtctgcttactagcactcaccggcact ttcatccacggacataacttcagtattgccattaaggagatcatcaaaacgttgaacatc ctcacagcgagaaacgactcatgcatggagctgaccgtcaccgaagtcttctctgcccca aagaacacaagtgagaaggaaatcttctgcagagctgcaactgtgcttcagcagctctct ccacacaattgctccaacagattgctcagaggacttcacaggaacctcaggaacatggca aacatgacctgttcggtgaatgaagtcaagaagagtacactgaaagacttcttggaaagg ctaaaagtgatcatgcaacagaaatactacaggcactga

DBGET integrated database retrieval system