Morus notabilis: 21410023 Help Entry 21410023          CDS       T07292                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism mnt  Morus notabilis Pathway mnt03420   Nucleotide excision repair mnt04120   Ubiquitin mediated proteolysis mnt04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:mnt00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     21410023    04120 Ubiquitin mediated proteolysis     21410023   09124 Replication and repair    03420 Nucleotide excision repair     21410023  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:mnt04121]     21410023    03400 DNA repair and recombination proteins [BR:mnt03400]     21410023 Enzymes [BR:mnt01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      21410023 Ubiquitin system [BR:mnt04121]  Ubiquitin ligases (E3)   UBL E3 ligases    21410023   Multi subunit type E3    SCF complex     Ring finger protein      21410023    Cul2 complex      21410023    Cul3 complex      21410023    Cul4 complex      21410023    Cul7 complex      21410023    Cul8 complex      21410023    Cul9 complex      21410023 DNA repair and recombination proteins [BR:mnt03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       21410023     TCR (transcription coupled repair) factors      Cul4-CSA complex       21410023 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  21410023 NCBI-ProteinID:  XP_024017218 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MATLDTDVPMVPAGEPSSSAGPSSKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMDL CIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggcgaccttggataccgacgttcccatggttcccgccggcgagccctcgagcagcgcc ggtccttccagcaagaagcccaagcgattcgagatcaagaagtggaacgccgtcgctctc tgggcctgggatattgttgttgataactgtgcgatctgcagaaaccacatcatggatctc tgtatcgagtgccaagcgaaccaagctagcgccacaagcgaggagtgtacggttgcttgg ggggtctgtaaccatgcgtttcatttccactgcattagccgatggctgaagacacgtcaa gtttgcccactggataacagtgagtgggagtttcagaagtatgggcactag

DBGET integrated database retrieval system