Microtus oregoni (creeping vole): 121435312 Help Entry 121435312         CDS       T08307                                  Symbol Tnf Name (RefSeq) tumor necrosis factor isoform X1   KO K03156   tumor necrosis factor superfamily, member 2 Organism morg  Microtus oregoni (creeping vole) Pathway morg01523   Antifolate resistance morg04010   MAPK signaling pathway morg04060   Cytokine-cytokine receptor interaction morg04061   Viral protein interaction with cytokine and cytokine receptor morg04064   NF-kappa B signaling pathway morg04071   Sphingolipid signaling pathway morg04150   mTOR signaling pathway morg04210   Apoptosis morg04217   Necroptosis morg04350   TGF-beta signaling pathway morg04380   Osteoclast differentiation morg04612   Antigen processing and presentation morg04620   Toll-like receptor signaling pathway morg04621   NOD-like receptor signaling pathway morg04622   RIG-I-like receptor signaling pathway morg04625   C-type lectin receptor signaling pathway morg04640   Hematopoietic cell lineage morg04650   Natural killer cell mediated cytotoxicity morg04657   IL-17 signaling pathway morg04660   T cell receptor signaling pathway morg04664   Fc epsilon RI signaling pathway morg04668   TNF signaling pathway morg04920   Adipocytokine signaling pathway morg04930   Type II diabetes mellitus morg04931   Insulin resistance morg04932   Non-alcoholic fatty liver disease morg04933   AGE-RAGE signaling pathway in diabetic complications morg04936   Alcoholic liver disease morg04940   Type I diabetes mellitus morg05010   Alzheimer disease morg05014   Amyotrophic lateral sclerosis morg05020   Prion disease morg05022   Pathways of neurodegeneration - multiple diseases morg05132   Salmonella infection morg05133   Pertussis morg05134   Legionellosis morg05135   Yersinia infection morg05140   Leishmaniasis morg05142   Chagas disease morg05143   African trypanosomiasis morg05144   Malaria morg05145   Toxoplasmosis morg05146   Amoebiasis morg05152   Tuberculosis morg05160   Hepatitis C morg05161   Hepatitis B morg05163   Human cytomegalovirus infection morg05164   Influenza A morg05165   Human papillomavirus infection morg05166   Human T-cell leukemia virus 1 infection morg05168   Herpes simplex virus 1 infection morg05169   Epstein-Barr virus infection morg05170   Human immunodeficiency virus 1 infection morg05171   Coronavirus disease - COVID-19 morg05205   Proteoglycans in cancer morg05310   Asthma morg05321   Inflammatory bowel disease morg05322   Systemic lupus erythematosus morg05323   Rheumatoid arthritis morg05330   Allograft rejection morg05332   Graft-versus-host disease morg05410   Hypertrophic cardiomyopathy morg05414   Dilated cardiomyopathy morg05417   Lipid and atherosclerosis morg05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:morg00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     121435312 (Tnf)    04350 TGF-beta signaling pathway     121435312 (Tnf)    04064 NF-kappa B signaling pathway     121435312 (Tnf)    04668 TNF signaling pathway     121435312 (Tnf)    04071 Sphingolipid signaling pathway     121435312 (Tnf)    04150 mTOR signaling pathway     121435312 (Tnf)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     121435312 (Tnf)    04061 Viral protein interaction with cytokine and cytokine receptor     121435312 (Tnf)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     121435312 (Tnf)    04217 Necroptosis     121435312 (Tnf)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     121435312 (Tnf)    04620 Toll-like receptor signaling pathway     121435312 (Tnf)    04621 NOD-like receptor signaling pathway     121435312 (Tnf)    04622 RIG-I-like receptor signaling pathway     121435312 (Tnf)    04625 C-type lectin receptor signaling pathway     121435312 (Tnf)    04650 Natural killer cell mediated cytotoxicity     121435312 (Tnf)    04612 Antigen processing and presentation     121435312 (Tnf)    04660 T cell receptor signaling pathway     121435312 (Tnf)    04657 IL-17 signaling pathway     121435312 (Tnf)    04664 Fc epsilon RI signaling pathway     121435312 (Tnf)   09152 Endocrine system    04920 Adipocytokine signaling pathway     121435312 (Tnf)   09158 Development and regeneration    04380 Osteoclast differentiation     121435312 (Tnf)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     121435312 (Tnf)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     121435312 (Tnf)    05170 Human immunodeficiency virus 1 infection     121435312 (Tnf)    05161 Hepatitis B     121435312 (Tnf)    05160 Hepatitis C     121435312 (Tnf)    05171 Coronavirus disease - COVID-19     121435312 (Tnf)    05164 Influenza A     121435312 (Tnf)    05168 Herpes simplex virus 1 infection     121435312 (Tnf)    05163 Human cytomegalovirus infection     121435312 (Tnf)    05169 Epstein-Barr virus infection     121435312 (Tnf)    05165 Human papillomavirus infection     121435312 (Tnf)   09171 Infectious disease: bacterial    05132 Salmonella infection     121435312 (Tnf)    05135 Yersinia infection     121435312 (Tnf)    05133 Pertussis     121435312 (Tnf)    05134 Legionellosis     121435312 (Tnf)    05152 Tuberculosis     121435312 (Tnf)   09174 Infectious disease: parasitic    05146 Amoebiasis     121435312 (Tnf)    05144 Malaria     121435312 (Tnf)    05145 Toxoplasmosis     121435312 (Tnf)    05140 Leishmaniasis     121435312 (Tnf)    05142 Chagas disease     121435312 (Tnf)    05143 African trypanosomiasis     121435312 (Tnf)   09163 Immune disease    05310 Asthma     121435312 (Tnf)    05322 Systemic lupus erythematosus     121435312 (Tnf)    05323 Rheumatoid arthritis     121435312 (Tnf)    05321 Inflammatory bowel disease     121435312 (Tnf)    05330 Allograft rejection     121435312 (Tnf)    05332 Graft-versus-host disease     121435312 (Tnf)   09164 Neurodegenerative disease    05010 Alzheimer disease     121435312 (Tnf)    05014 Amyotrophic lateral sclerosis     121435312 (Tnf)    05020 Prion disease     121435312 (Tnf)    05022 Pathways of neurodegeneration - multiple diseases     121435312 (Tnf)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     121435312 (Tnf)    05418 Fluid shear stress and atherosclerosis     121435312 (Tnf)    05410 Hypertrophic cardiomyopathy     121435312 (Tnf)    05414 Dilated cardiomyopathy     121435312 (Tnf)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     121435312 (Tnf)    04940 Type I diabetes mellitus     121435312 (Tnf)    04936 Alcoholic liver disease     121435312 (Tnf)    04932 Non-alcoholic fatty liver disease     121435312 (Tnf)    04931 Insulin resistance     121435312 (Tnf)    04933 AGE-RAGE signaling pathway in diabetic complications     121435312 (Tnf)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     121435312 (Tnf)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:morg04052]     121435312 (Tnf)    00536 Glycosaminoglycan binding proteins [BR:morg00536]     121435312 (Tnf) Cytokines and neuropeptides [BR:morg04052]  Cytokines   Tumor necrosis fators    121435312 (Tnf) Glycosaminoglycan binding proteins [BR:morg00536]  Heparan sulfate / Heparin   Cytokines    121435312 (Tnf) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  TNF Motif Other DBs NCBI-GeneID:  121435312 NCBI-ProteinID:  XP_041490488 LinkDB All DBs Position Unknown AA seq 235 aa AA seqDB search MSTESMIRDVELAEEALPKKAWGPQNSSRCLCLSLFSFLLVAGATTLFCLLNFGVIGPQR EEKFPNNLPIIGSMAQTLTLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGM DLKDNQLVIPADGLYLVYSQVLFKGQGCSSYVLLTHTVSRIAVSYEDKVNLLSAIKSPCP KETPEGAELKPWYEPIYLGGVFQLEKGDRLSAEVNLPKYLDFAESGQVYFGVIAL NT seq 708 nt NT seq  +upstreamnt  +downstreamnt atgagcacagaaagcatgatccgcgatgtggaactggcagaggaggcactccccaaaaag gcgtggggcccccagaactccagtcgctgcctgtgcctcagcctcttctccttcctgctt gtggcaggggccaccacgctcttctgtctgctgaacttcggagtgatcggcccccaaagg gaagagaagttcccaaacaacctccctatcattggctccatggctcagaccctcaccctc aggtcatcttctcaaaattcgagtgacaaacctgtagcccacgttgtagcaaaccaccaa gtggaggagcagctggaatggctgagccagcgtgccaatgccctcctggccaatggcatg gatctcaaagacaaccagctggtgatacccgcagatggactgtacctcgtctactcccag gttctcttcaagggccaaggttgctccagctacgtgctcctcacccacaccgtcagccgc attgctgtctcctatgaggacaaagtcaacctcctgtctgccatcaagagcccctgcccc aaggaaacccctgagggggctgagctcaagccctggtatgagcccatctacctgggaggg gtcttccagctggagaagggcgaccgactcagtgctgaggtcaacctgcccaaatattta gactttgcagagtctgggcaggtctactttggtgtcatagctctgtga

DBGET integrated database retrieval system