Microtus oregoni (creeping vole): 121441819 Help Entry 121441819         CDS       T08307                                  Symbol Nppa Name (RefSeq) natriuretic peptides A   KO K12334   natriuretic peptide A Organism morg  Microtus oregoni (creeping vole) Pathway morg04022   cGMP-PKG signaling pathway morg04024   cAMP signaling pathway morg04066   HIF-1 signaling pathway morg04081   Hormone signaling morg04270   Vascular smooth muscle contraction morg04714   Thermogenesis morg04921   Oxytocin signaling pathway morg04923   Regulation of lipolysis in adipocytes morg04924   Renin secretion morg04925   Aldosterone synthesis and secretion morg05143   African trypanosomiasis Brite KEGG Orthology (KO) [BR:morg00001]  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     121441819 (Nppa)    04024 cAMP signaling pathway     121441819 (Nppa)    04022 cGMP-PKG signaling pathway     121441819 (Nppa)   09133 Signaling molecules and interaction    04081 Hormone signaling     121441819 (Nppa)  09150 Organismal Systems   09152 Endocrine system    04923 Regulation of lipolysis in adipocytes     121441819 (Nppa)    04921 Oxytocin signaling pathway     121441819 (Nppa)    04924 Renin secretion     121441819 (Nppa)    04925 Aldosterone synthesis and secretion     121441819 (Nppa)   09153 Circulatory system    04270 Vascular smooth muscle contraction     121441819 (Nppa)   09159 Environmental adaptation    04714 Thermogenesis     121441819 (Nppa)  09160 Human Diseases   09174 Infectious disease: parasitic    05143 African trypanosomiasis     121441819 (Nppa)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:morg04052]     121441819 (Nppa) Cytokines and neuropeptides [BR:morg04052]  Neuropeptides   Unclassified    121441819 (Nppa) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  121441819 NCBI-ProteinID:  XP_041499076 LinkDB All DBs Position Unknown AA seq 152 aa AA seqDB search MGSFSITMGFFFFLAFWLPGHIGANPVYSAVSNTDLMDFKNLLDHLEEKMPLEDEVMPPQ TPSEQNDEAGAALSSLPEIPPWTGEVNPPQRDGSTLGRSPWDPSDRAALLKSKLRALLAA PRSLRRSSCFGGRIDRIGAQSGLGCNSFRYRR NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atgggctccttctccatcaccatgggcttcttcttctttcttgccttttggcttccaggc catattggagcaaaccctgtgtacagtgcagtatccaacacagatctgatggatttcaag aacctgctagaccatctggaagagaagatgccattagaagatgaggtcatgcccccacag accccgagtgagcagaacgatgaagcaggggccgcgcttagctctctccctgagatacct ccctggacaggggaggtcaacccacctcagagagatgggagtaccctcgggcgcagtccc tgggacccctccgatagagctgctctcttgaaaagcaaactgagggctctgctcgctgcc cctcggagcctacggaggtccagctgctttgggggtaggatcgacaggattggagcccag agcggactaggatgcaacagcttccggtaccgaagataa

DBGET integrated database retrieval system