Microtus oregoni (creeping vole): 121445651 Help Entry 121445651         CDS       T08307                                  Symbol Il4 Name (RefSeq) interleukin-4   KO K05430   interleukin 4 Organism morg  Microtus oregoni (creeping vole) Pathway morg04060   Cytokine-cytokine receptor interaction morg04151   PI3K-Akt signaling pathway morg04630   JAK-STAT signaling pathway morg04640   Hematopoietic cell lineage morg04657   IL-17 signaling pathway morg04658   Th1 and Th2 cell differentiation morg04659   Th17 cell differentiation morg04660   T cell receptor signaling pathway morg04664   Fc epsilon RI signaling pathway morg04672   Intestinal immune network for IgA production morg05140   Leishmaniasis morg05200   Pathways in cancer morg05310   Asthma morg05320   Autoimmune thyroid disease morg05321   Inflammatory bowel disease morg05330   Allograft rejection Brite KEGG Orthology (KO) [BR:morg00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     121445651 (Il4)    04151 PI3K-Akt signaling pathway     121445651 (Il4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     121445651 (Il4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     121445651 (Il4)    04660 T cell receptor signaling pathway     121445651 (Il4)    04658 Th1 and Th2 cell differentiation     121445651 (Il4)    04659 Th17 cell differentiation     121445651 (Il4)    04657 IL-17 signaling pathway     121445651 (Il4)    04664 Fc epsilon RI signaling pathway     121445651 (Il4)    04672 Intestinal immune network for IgA production     121445651 (Il4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     121445651 (Il4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     121445651 (Il4)   09163 Immune disease    05310 Asthma     121445651 (Il4)    05320 Autoimmune thyroid disease     121445651 (Il4)    05321 Inflammatory bowel disease     121445651 (Il4)    05330 Allograft rejection     121445651 (Il4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:morg04052]     121445651 (Il4)    00536 Glycosaminoglycan binding proteins [BR:morg00536]     121445651 (Il4) Cytokines and neuropeptides [BR:morg04052]  Cytokines   Interleukins    121445651 (Il4) Glycosaminoglycan binding proteins [BR:morg00536]  Heparan sulfate / Heparin   Cytokines    121445651 (Il4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL4 Pox_D3 Motif Other DBs NCBI-GeneID:  121445651 NCBI-ProteinID:  XP_041503727 LinkDB All DBs Position Unknown AA seq 148 aa AA seqDB search MGLSPQGAAILLCLLACTGNSTHGCNGRALKESIHILNQVTEKGTPCTDRMNVSDILTAR NNTTERELMCKTFKVLHKFYTPHETLCLANNPRLLKDLKRLIRNIYGLSPSPRNCTVNES THTTLTDFLGSLKRIMQRNYWLCGSSKS NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atgggtctcagcccccagggagctgctatcttgctctgccttctagcatgtactgggaac tctacccacggatgcaacggcagagccttgaaagagagcatccacattttgaaccaggtc acagaaaaagggacgccatgcaccgacagaatgaacgtatcagacatcctgacagcgaga aacaacaccacggagagggaacttatgtgcaagactttcaaggtgcttcacaagttctat accccacatgagactctgtgcttggcaaacaatcccaggcttctcaaagacctgaaaaga ctcatcaggaacatctacggcctgtctccatcgccgagaaactgcactgtgaatgagtcc acgcacacaacactgacagacttcttgggaagcctaaaaaggatcatgcaaaggaattac tggctgtgtgggagctccaagtcttaa

DBGET integrated database retrieval system