Microtus oregoni (creeping vole): 121447990 Help Entry 121447990         CDS       T08307                                  Symbol Ifnb1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism morg  Microtus oregoni (creeping vole) Pathway morg04060   Cytokine-cytokine receptor interaction morg04151   PI3K-Akt signaling pathway morg04217   Necroptosis morg04380   Osteoclast differentiation morg04620   Toll-like receptor signaling pathway morg04621   NOD-like receptor signaling pathway morg04622   RIG-I-like receptor signaling pathway morg04623   Cytosolic DNA-sensing pathway morg04630   JAK-STAT signaling pathway morg04650   Natural killer cell mediated cytotoxicity morg04668   TNF signaling pathway morg04936   Alcoholic liver disease morg05135   Yersinia infection morg05142   Chagas disease morg05152   Tuberculosis morg05160   Hepatitis C morg05161   Hepatitis B morg05162   Measles morg05163   Human cytomegalovirus infection morg05164   Influenza A morg05165   Human papillomavirus infection morg05167   Kaposi sarcoma-associated herpesvirus infection morg05168   Herpes simplex virus 1 infection morg05169   Epstein-Barr virus infection morg05170   Human immunodeficiency virus 1 infection morg05171   Coronavirus disease - COVID-19 morg05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:morg00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     121447990 (Ifnb1)    04668 TNF signaling pathway     121447990 (Ifnb1)    04151 PI3K-Akt signaling pathway     121447990 (Ifnb1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     121447990 (Ifnb1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     121447990 (Ifnb1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     121447990 (Ifnb1)    04621 NOD-like receptor signaling pathway     121447990 (Ifnb1)    04622 RIG-I-like receptor signaling pathway     121447990 (Ifnb1)    04623 Cytosolic DNA-sensing pathway     121447990 (Ifnb1)    04650 Natural killer cell mediated cytotoxicity     121447990 (Ifnb1)   09158 Development and regeneration    04380 Osteoclast differentiation     121447990 (Ifnb1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     121447990 (Ifnb1)    05161 Hepatitis B     121447990 (Ifnb1)    05160 Hepatitis C     121447990 (Ifnb1)    05171 Coronavirus disease - COVID-19     121447990 (Ifnb1)    05164 Influenza A     121447990 (Ifnb1)    05162 Measles     121447990 (Ifnb1)    05168 Herpes simplex virus 1 infection     121447990 (Ifnb1)    05163 Human cytomegalovirus infection     121447990 (Ifnb1)    05167 Kaposi sarcoma-associated herpesvirus infection     121447990 (Ifnb1)    05169 Epstein-Barr virus infection     121447990 (Ifnb1)    05165 Human papillomavirus infection     121447990 (Ifnb1)   09171 Infectious disease: bacterial    05135 Yersinia infection     121447990 (Ifnb1)    05152 Tuberculosis     121447990 (Ifnb1)   09174 Infectious disease: parasitic    05142 Chagas disease     121447990 (Ifnb1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     121447990 (Ifnb1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     121447990 (Ifnb1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:morg04052]     121447990 (Ifnb1) Cytokines and neuropeptides [BR:morg04052]  Cytokines   Interferons    121447990 (Ifnb1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon RKP_N Motif Other DBs NCBI-GeneID:  121447990 NCBI-ProteinID:  XP_041507421 LinkDB All DBs Position Unknown AA seq 181 aa AA seqDB search MTNRCILQAAFLLGFLSVALSINYEDLERRQSSTNSACLELLEQLDEQLCLDHRINFKIP MEVKRLGRMEKKVAVIFIREMLQNIFNVFKNDSSSTGWNRKIVESFLGILGDQIDFLNKV LANERWTSSNFPTVLRLKSYYGRVQSFLEVKGHSSCAWMVVRAEILKNFSIIKRLTNTFQ N NT seq 546 nt NT seq  +upstreamnt  +downstreamnt atgaccaacaggtgtatcctccaagctgcattcctgcttgggtttctctccgtagccctg tccatcaactacgaggaccttgagcgcagacaaagcagcaccaattcagcatgtctggag ctcctggaacagctggatgaacagctctgccttgaccacagaataaacttcaagatccct atggaggtgaagcgcctagggcggatggagaagaaagtcgccgtcatcttcatccgagag atgctccagaatatcttcaatgtcttcaaaaacgattcctccagcactgggtggaatagg aaaatcgttgaaagcttcttgggtatactcggtgatcagatagactttctgaacaaagtc ctagcgaatgaaagatggacatcgagcaacttcccaaccgttctacgtttgaagagctat tacgggagggtgcaaagcttccttgaagtcaaggggcacagcagctgcgcctggatggta gtccgagcagaaatcctcaagaacttttccatcatcaaaagacttactaatacattccag aactga

DBGET integrated database retrieval system