Microtus oregoni (creeping vole): 121460941 Help Entry 121460941         CDS       T08307                                  Name (RefSeq) C-X-C motif chemokine 3-like   KO K05505   C-X-C motif chemokine 1/2/3 Organism morg  Microtus oregoni (creeping vole) Pathway morg04060   Cytokine-cytokine receptor interaction morg04061   Viral protein interaction with cytokine and cytokine receptor morg04062   Chemokine signaling pathway morg04064   NF-kappa B signaling pathway morg04621   NOD-like receptor signaling pathway morg04657   IL-17 signaling pathway morg04668   TNF signaling pathway morg04936   Alcoholic liver disease morg05134   Legionellosis morg05146   Amoebiasis morg05167   Kaposi sarcoma-associated herpesvirus infection morg05323   Rheumatoid arthritis morg05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:morg00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     121460941    04668 TNF signaling pathway     121460941   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     121460941    04061 Viral protein interaction with cytokine and cytokine receptor     121460941  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     121460941    04657 IL-17 signaling pathway     121460941    04062 Chemokine signaling pathway     121460941  09160 Human Diseases   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     121460941   09171 Infectious disease: bacterial    05134 Legionellosis     121460941   09174 Infectious disease: parasitic    05146 Amoebiasis     121460941   09163 Immune disease    05323 Rheumatoid arthritis     121460941   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     121460941   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     121460941  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:morg04052]     121460941 Cytokines and neuropeptides [BR:morg04052]  Cytokines   Chemokines    121460941 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  121460941 NCBI-ProteinID:  XP_041527574 LinkDB All DBs Position Unknown AA seq 102 aa AA seqDB search MAPAIRPLLSAVLLLLLLLATSHQATGTIVASELRCKCPNTIPRIALEEIQSLKVTPSGP HCTQTEVIATLKNGKEFCLDPEGPRLQKIIQKILKTKTASSS NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atggccccagccatacgtcctctcctgagtgcagtgctgctgttgctgctgctgttggcc accagccaccaggctacaggaacaattgtggccagtgaactgcgctgtaagtgccctaac accataccaaggattgctttggaggaaatccagagcttgaaggtgacgccctcaggaccc cactgcacccagacagaagtcatagccactctcaagaatggtaaagaattttgtctggat cccgaaggccctaggcttcagaagatcatccaaaagatcctgaagacgaagaccgccagc tccagctga

DBGET integrated database retrieval system