Microtus oregoni (creeping vole): 121461538 Help Entry 121461538         CDS       T08307                                  Symbol Rap1b Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism morg  Microtus oregoni (creeping vole) Pathway morg04010   MAPK signaling pathway morg04014   Ras signaling pathway morg04015   Rap1 signaling pathway morg04024   cAMP signaling pathway morg04062   Chemokine signaling pathway morg04510   Focal adhesion morg04517   IgSF CAM signaling morg04520   Adherens junction morg04611   Platelet activation morg04670   Leukocyte transendothelial migration morg04720   Long-term potentiation morg04722   Neurotrophin signaling pathway morg04934   Cushing syndrome morg04972   Pancreatic secretion morg05211   Renal cell carcinoma morg05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:morg00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     121461538 (Rap1b)    04014 Ras signaling pathway     121461538 (Rap1b)    04015 Rap1 signaling pathway     121461538 (Rap1b)    04024 cAMP signaling pathway     121461538 (Rap1b)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     121461538 (Rap1b)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     121461538 (Rap1b)    04520 Adherens junction     121461538 (Rap1b)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     121461538 (Rap1b)    04670 Leukocyte transendothelial migration     121461538 (Rap1b)    04062 Chemokine signaling pathway     121461538 (Rap1b)   09154 Digestive system    04972 Pancreatic secretion     121461538 (Rap1b)   09156 Nervous system    04720 Long-term potentiation     121461538 (Rap1b)    04722 Neurotrophin signaling pathway     121461538 (Rap1b)  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     121461538 (Rap1b)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     121461538 (Rap1b)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     121461538 (Rap1b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:morg04147]     121461538 (Rap1b)    04031 GTP-binding proteins [BR:morg04031]     121461538 (Rap1b) Exosome [BR:morg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121461538 (Rap1b)   Exosomal proteins of other body fluids (saliva and urine)    121461538 (Rap1b)   Exosomal proteins of colorectal cancer cells    121461538 (Rap1b) GTP-binding proteins [BR:morg04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     121461538 (Rap1b) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  121461538 NCBI-ProteinID:  XP_041528581 LinkDB All DBs Position Unknown AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgaatataagctcgtcgttcttggctcaggaggtgttggaaagtcagctctgact gtacagtttgttcaaggaatttttgttgaaaaatatgaccctacgatagaagattcttac agaaagcaagttgaagtagatgcacagcagtgtatgcttgaaatcctggacactgcagga acggaacaatttacagcaatgagagatttgtacatgaagaatggccagggcttcgctttg gtttactcgatcacggcgcagtccacgtttaatgacttacaagacctgagagagcagatt cttcgggttaaagacactgacgatgttccaatgattcttgtgggcaataaatgtgacttg gaagacgaaagagttgtagggaaggaacaaggtcaaaacctagcaagacaatggaacaac tgtgcattcttagaatcttctgcaaaatcaaaaataaacgttaatgagatcttttatgat ctagtgcggcaaattaacagaaaaactccagtgcctggcaaggcccgcaaaaagtcgtca tgccagctgctttaa

DBGET integrated database retrieval system