Microtus oregoni (creeping vole): 121465037 Help Entry 121465037         CDS       T08307                                  Name (RefSeq) CD209 antigen-like protein E   KO K06563   C-type lectin domain family 4 member L/M Organism morg  Microtus oregoni (creeping vole) Pathway morg03260   Virion - Human immunodeficiency virus morg03264   Virion - Flavivirus and Alphavirus morg03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus morg03273   Virion - Lassa virus and SFTS virus morg04145   Phagosome morg04625   C-type lectin receptor signaling pathway morg05152   Tuberculosis morg05162   Measles Brite KEGG Orthology (KO) [BR:morg00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     121465037    03264 Virion - Flavivirus and Alphavirus     121465037    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     121465037    03273 Virion - Lassa virus and SFTS virus     121465037  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     121465037  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     121465037  09160 Human Diseases   09172 Infectious disease: viral    05162 Measles     121465037   09171 Infectious disease: bacterial    05152 Tuberculosis     121465037  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:morg04131]     121465037   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:morg04054]     121465037    04515 Cell adhesion molecules [BR:morg04515]     121465037    04090 CD molecules [BR:morg04090]     121465037    04091 Lectins [BR:morg04091]     121465037 Membrane trafficking [BR:morg04131]  Endocytosis   Phagocytosis    C-lectin receptors     121465037 Pattern recognition receptors [BR:morg04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    121465037 Cell adhesion molecules [BR:morg04515]  Lectins   Selectins and C-type lectins    121465037 CD molecules [BR:morg04090]  Proteins   121465037 Lectins [BR:morg04091]  C-Type lectins   Asialoglycoprotein and DC receptors    121465037 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Lectin_C Chordopox_A33R Motif Other DBs NCBI-GeneID:  121465037 NCBI-ProteinID:  XP_041534134 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MTVGDSKEAGVQQMGCLGFLDRGHISLALQLLSLIFFAGLLAAIITQVSKIPSSEEIQWE QKKQEKMFQDLSQMKSEVDSLCRRCPWDWTFFKGNCYFFSKSQRDWHDSITACQEVGAQL VIIKSLEEQYFLQQASKKNGYTWMGLSDLNKEGAWYWLDGSPLSDRFARYWNKGQPNNFG GQDCVEFRDDGWNDAKCDDMKLWICKKSSTTCPSK NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgactgtgggtgactccaaagaagcaggggtgcagcagatgggctgtctgggatttctg gaccgaggccacatctccctggcgctgcagctgctgtcactcattttctttgccggactc ctggctgccatcatcacccaagtttccaagatccccagctcagaggaaatacagtgggaa cagaaaaagcaggagaaaatgttccaggacctgagccagatgaagtctgaagttgatagc ctctgtcgccgctgtccttgggattggacattcttcaagggaaactgttacttcttctcc aagtcacaacgggactggcatgactccatcactgcctgccaggaagtgggagcccagctg gtcatcatcaaaagtcttgaggagcagtacttcctgcagcaagcttccaagaaaaatggc tacacctggatggggttgtcagacctgaacaaggaaggtgcatggtattggctggatggt tcacctctgtcagacagatttgcgaggtactggaataaaggacagcccaacaactttggg ggacaagactgtgtggaattcagagatgacggctggaatgatgccaaatgtgatgacatg aaattatggatctgcaaaaaatcctcaactacctgtcccagcaagtga

DBGET integrated database retrieval system