KEGG   Mus pahari (shrew mouse): 110313074
Entry
110313074         CDS       T05929                                 

Symbol
Actb
Name
(RefSeq) actin, cytoplasmic 1
  KO
K05692  actin beta/gamma 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04015  Rap1 signaling pathway
mpah04145  Phagosome
mpah04210  Apoptosis
mpah04390  Hippo signaling pathway
mpah04510  Focal adhesion
mpah04520  Adherens junction
mpah04530  Tight junction
mpah04611  Platelet activation
mpah04613  Neutrophil extracellular trap formation
mpah04670  Leukocyte transendothelial migration
mpah04714  Thermogenesis
mpah04810  Regulation of actin cytoskeleton
mpah04919  Thyroid hormone signaling pathway
mpah04921  Oxytocin signaling pathway
mpah04971  Gastric acid secretion
mpah05014  Amyotrophic lateral sclerosis
mpah05100  Bacterial invasion of epithelial cells
mpah05132  Salmonella infection
mpah05135  Yersinia infection
mpah05164  Influenza A
mpah05205  Proteoglycans in cancer
mpah05225  Hepatocellular carcinoma
mpah05410  Hypertrophic cardiomyopathy
mpah05412  Arrhythmogenic right ventricular cardiomyopathy
mpah05414  Dilated cardiomyopathy
mpah05416  Viral myocarditis
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110313074 (Actb)
   04390 Hippo signaling pathway
    110313074 (Actb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110313074 (Actb)
  09143 Cell growth and death
   04210 Apoptosis
    110313074 (Actb)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110313074 (Actb)
   04520 Adherens junction
    110313074 (Actb)
   04530 Tight junction
    110313074 (Actb)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110313074 (Actb)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110313074 (Actb)
   04613 Neutrophil extracellular trap formation
    110313074 (Actb)
   04670 Leukocyte transendothelial migration
    110313074 (Actb)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    110313074 (Actb)
   04919 Thyroid hormone signaling pathway
    110313074 (Actb)
  09154 Digestive system
   04971 Gastric acid secretion
    110313074 (Actb)
  09159 Environmental adaptation
   04714 Thermogenesis
    110313074 (Actb)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    110313074 (Actb)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110313074 (Actb)
  09172 Infectious disease: viral
   05164 Influenza A
    110313074 (Actb)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110313074 (Actb)
   05135 Yersinia infection
    110313074 (Actb)
   05100 Bacterial invasion of epithelial cells
    110313074 (Actb)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    110313074 (Actb)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110313074 (Actb)
   05410 Hypertrophic cardiomyopathy
    110313074 (Actb)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110313074 (Actb)
   05414 Dilated cardiomyopathy
    110313074 (Actb)
   05416 Viral myocarditis
    110313074 (Actb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mpah03021]
    110313074 (Actb)
   03019 Messenger RNA biogenesis [BR:mpah03019]
    110313074 (Actb)
   03036 Chromosome and associated proteins [BR:mpah03036]
    110313074 (Actb)
   03029 Mitochondrial biogenesis [BR:mpah03029]
    110313074 (Actb)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mpah04812]
    110313074 (Actb)
   04147 Exosome [BR:mpah04147]
    110313074 (Actb)
Transcription machinery [BR:mpah03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     110313074 (Actb)
Messenger RNA biogenesis [BR:mpah03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     110313074 (Actb)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     110313074 (Actb)
    NuA4 complex
     110313074 (Actb)
  Chromatin remodeling factors
   BAF complex
    110313074 (Actb)
   PBAF complex
    110313074 (Actb)
   SWR1 complex
    110313074 (Actb)
Mitochondrial biogenesis [BR:mpah03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    110313074 (Actb)
Cytoskeleton proteins [BR:mpah04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     110313074 (Actb)
Exosome [BR:mpah04147]
 Exosomal proteins
  Proteins found in most exosomes
   110313074 (Actb)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 110313074
NCBI-ProteinID: XP_021042765
Ensembl: MGP_PahariEiJ_G0024540
LinkDB
Position
23
AA seq 375 aa
MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWXDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggatgacgatatcgctgcgctcgtcgtcgacaacggctccggcatgtgcaaagccggc
ttcgcgggagatgatgcaccccgggccgtcttcccctccatcgtgggccgccctaggcac
cagggtgtgatggtgggtatgggtcagaaggactcctacgtgggcgacgaggcccagagc
aagagaggcatcctgaccctgaagtaccccattgaacacggcattgtcaccaactgggan
gacatggagaagatctggcaccacaccttctacaatgagctgcgtgtggcccctgaggag
caccctgtgctgctcaccgaggcccccctgaaccctaaggccaaccgtgaaaagatgacc
cagatcatgtttgagaccttcaacaccccagccatgtacgtagccatccaggctgtgctg
tccctgtatgcctctggtcgtaccactggcattgtgatggactccggagacggggtcacc
cacactgtgcccatctacgagggctatgctctccctcatgccatcctgcgtctggacctg
gctggccgggacctgacagactacctcatgaagatcctgaccgagcgtggctacagcttc
accaccacagctgagagggaaatcgtgcgtgacatcaaagagaagctgtgctatgttgcc
ctagacttcgagcaggagatggccactgccgcatcctcttcctccctggagaagagctat
gagctgcctgacggccaggtcatcactattggcaacgagcgcttccggtgccctgaggct
cttttccagccttccttcttgggtatggaatcctgtggtatccatgaaactacattcaat
tccatcatgaagtgtgacgttgacatccgtaaagacctctatgccaacacagtgctgtct
ggtggcaccaccatgtacccaggcattgctgacaggatgcagaaggagatcactgctctg
gctcctagcaccatgaagatcaagatcattgctcctcctgagcgcaagtactctgtgtgg
atcggtggctccatcctggcctccctgtccaccttccagcagatgtggatcagcaagcag
gagtacgatgagtccggcccctccatcgtgcaccgcaagtgcttctag

DBGET integrated database retrieval system