KEGG   Mus pahari (shrew mouse): 110317139
Entry
110317139         CDS       T05929                                 
Symbol
Cd4
Name
(RefSeq) T-cell surface glycoprotein CD4 isoform X1
  KO
K06454  T-cell surface glycoprotein CD4
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah03250  Viral life cycle - HIV-1
mpah04060  Cytokine-cytokine receptor interaction
mpah04514  Cell adhesion molecules
mpah04612  Antigen processing and presentation
mpah04640  Hematopoietic cell lineage
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah04660  T cell receptor signaling pathway
mpah05135  Yersinia infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mpah05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03250 Viral life cycle - HIV-1
    110317139 (Cd4)
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110317139 (Cd4)
   04514 Cell adhesion molecules
    110317139 (Cd4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110317139 (Cd4)
   04612 Antigen processing and presentation
    110317139 (Cd4)
   04660 T cell receptor signaling pathway
    110317139 (Cd4)
   04658 Th1 and Th2 cell differentiation
    110317139 (Cd4)
   04659 Th17 cell differentiation
    110317139 (Cd4)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110317139 (Cd4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110317139 (Cd4)
   05170 Human immunodeficiency virus 1 infection
    110317139 (Cd4)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110317139 (Cd4)
  09163 Immune disease
   05340 Primary immunodeficiency
    110317139 (Cd4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mpah04090]
    110317139 (Cd4)
CD molecules [BR:mpah04090]
 Proteins
  110317139 (Cd4)
SSDB
Motif
Pfam: CD4-extracel C2-set ig V-set Ig_3 I-set Ig_2 Tcell_CD4_C Receptor_2B4
Other DBs
NCBI-GeneID: 110317139
NCBI-ProteinID: XP_021047194
Ensembl: MGP_PahariEiJ_G0022619
LinkDB
Position
2:complement(139987141..140011391)
AA seq 459 aa
MCRDISLRHLLLLLLQLSQLLAVTQGKTVVLGKEGASAELPCESSQKKITVFNWKLSDQR
KILGRQNNGVLIKGGSLLGFERFDSKKSAWEKGSFPLIINKLKMEDSQTYICEVENRKEE
VELRVYKVTFSPGTTLLQGQSLTLTLDINSKVSNPLIECKHKTGKIVKGSQVLSISNLRV
QDSDFWNCTVTLDQKKNWFGMTLSVLGFQSTSITAYKSEGESAEFSFPLNFAEESVKRGE
LVWKEEKAFFFRSWISFSIKNRAVSVEMSTKDLKLQLEKTLPLTLKIPQVSLQFAGSGNL
SLTLDKGTLHQEVNLVVMKVAQINNSLTCEVMGPTSPKMRLTLKQENQEARVSEKQKMVQ
VKAPETGMWQCLLSEGEKVQLDSRIQVLSRRVMNQTVLLAGVLGGALGFLAFLGLCIPCC
VKCRKQQRQAARMSQIKRLLSEKKTCQCPHRMQKTHNLI
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgtgccgagacatctctcttaggcacttgctgctgttgctgctgcagctgtcacaactc
ctagctgtcactcaagggaagaccgtggtgctggggaaagaaggggcatcagctgaactg
ccctgtgagagctcccagaagaagattacagtcttcaactggaagctctctgaccagaga
aagattctgggacgtcagaacaatggtgtattgattaaaggaggttcacttctggggttt
gaacgttttgattccaaaaaaagcgcatgggagaaaggatcgtttcctctcatcatcaat
aaacttaagatggaagactctcagacttatatctgcgaggtggagaacaggaaagaggag
gtggagttgcgggtgtacaaagtgaccttcagtccgggtaccaccctgttgcaagggcag
agcctgaccctgaccttggatatcaactctaaggtctctaaccccttgatagagtgcaaa
cacaaaacgggtaaaattgtcaagggttcccaagttctctccatatccaacctaagggtt
caggacagcgacttctggaactgcaccgtgaccctggaccagaaaaagaactggtttggc
atgacgctctcagtgctgggttttcagagcacatctatcacggcctataagagtgagggg
gagtcagcggagttctccttcccactcaactttgcagaggaaagcgtgaagagaggagag
ctggtgtggaaggaagagaaggcatttttcttccggtcctggatctccttctccataaag
aacagagccgtgtctgtagaaatgtccaccaaggacctcaagctccagctggagaaaacg
ctcccacttacactcaagataccccaggtctcgcttcagtttgctggctctggcaacctg
tctctgactctggacaaagggacactgcatcaggaagtgaacctggtggtgatgaaagtg
gctcagatcaacaacagtctgacctgtgaggtgatgggacctacctctcccaagatgaga
ctgaccctgaagcaggagaaccaggaggccagggtctctgagaagcagaaaatggttcaa
gtgaaggcccctgagacaggaatgtggcaatgtctactgagtgaaggtgaaaaggtccag
ctggactccaggatccaggttttatccagaagggtgatgaaccagacagtgctcctggct
ggcgtgctggggggcgccttgggctttctggctttccttgggctctgcatcccctgctgt
gtcaagtgccggaaacaacagcgccaggcagcacggatgtctcagatcaagaggctcctc
agtgagaagaagacctgccagtgcccccaccggatgcagaagacccataatctcatctga

DBGET integrated database retrieval system