KEGG   Mus pahari (shrew mouse): 110317140
Entry
110317140         CDS       T05929                                 

Gene name
Il6
Definition
(RefSeq) interleukin-6
  KO
K05405  interleukin 6
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah01523  Antifolate resistance
mpah04060  Cytokine-cytokine receptor interaction
mpah04061  Viral protein interaction with cytokine and cytokine receptor
mpah04066  HIF-1 signaling pathway
mpah04068  FoxO signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04218  Cellular senescence
mpah04620  Toll-like receptor signaling pathway
mpah04621  NOD-like receptor signaling pathway
mpah04623  Cytosolic DNA-sensing pathway
mpah04625  C-type lectin receptor signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04640  Hematopoietic cell lineage
mpah04657  IL-17 signaling pathway
mpah04659  Th17 cell differentiation
mpah04668  TNF signaling pathway
mpah04672  Intestinal immune network for IgA production
mpah04931  Insulin resistance
mpah04932  Non-alcoholic fatty liver disease
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah05010  Alzheimer disease
mpah05020  Prion disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05132  Salmonella infection
mpah05133  Pertussis
mpah05134  Legionellosis
mpah05135  Yersinia infection
mpah05142  Chagas disease
mpah05143  African trypanosomiasis
mpah05144  Malaria
mpah05146  Amoebiasis
mpah05152  Tuberculosis
mpah05161  Hepatitis B
mpah05162  Measles
mpah05163  Human cytomegalovirus infection
mpah05164  Influenza A
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05171  Coronavirus disease - COVID-19
mpah05200  Pathways in cancer
mpah05202  Transcriptional misregulation in cancer
mpah05321  Inflammatory bowel disease
mpah05323  Rheumatoid arthritis
mpah05332  Graft-versus-host disease
mpah05410  Hypertrophic cardiomyopathy
mpah05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110317140 (Il6)
   04668 TNF signaling pathway
    110317140 (Il6)
   04066 HIF-1 signaling pathway
    110317140 (Il6)
   04068 FoxO signaling pathway
    110317140 (Il6)
   04151 PI3K-Akt signaling pathway
    110317140 (Il6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110317140 (Il6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    110317140 (Il6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    110317140 (Il6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110317140 (Il6)
   04620 Toll-like receptor signaling pathway
    110317140 (Il6)
   04621 NOD-like receptor signaling pathway
    110317140 (Il6)
   04623 Cytosolic DNA-sensing pathway
    110317140 (Il6)
   04625 C-type lectin receptor signaling pathway
    110317140 (Il6)
   04659 Th17 cell differentiation
    110317140 (Il6)
   04657 IL-17 signaling pathway
    110317140 (Il6)
   04672 Intestinal immune network for IgA production
    110317140 (Il6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110317140 (Il6)
   05202 Transcriptional misregulation in cancer
    110317140 (Il6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110317140 (Il6)
   05161 Hepatitis B
    110317140 (Il6)
   05171 Coronavirus disease - COVID-19
    110317140 (Il6)
   05164 Influenza A
    110317140 (Il6)
   05162 Measles
    110317140 (Il6)
   05168 Herpes simplex virus 1 infection
    110317140 (Il6)
   05163 Human cytomegalovirus infection
    110317140 (Il6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110317140 (Il6)
   05169 Epstein-Barr virus infection
    110317140 (Il6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110317140 (Il6)
   05135 Yersinia infection
    110317140 (Il6)
   05133 Pertussis
    110317140 (Il6)
   05134 Legionellosis
    110317140 (Il6)
   05152 Tuberculosis
    110317140 (Il6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110317140 (Il6)
   05144 Malaria
    110317140 (Il6)
   05142 Chagas disease
    110317140 (Il6)
   05143 African trypanosomiasis
    110317140 (Il6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    110317140 (Il6)
   05321 Inflammatory bowel disease
    110317140 (Il6)
   05332 Graft-versus-host disease
    110317140 (Il6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110317140 (Il6)
   05020 Prion disease
    110317140 (Il6)
   05022 Pathways of neurodegeneration - multiple diseases
    110317140 (Il6)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110317140 (Il6)
   05410 Hypertrophic cardiomyopathy
    110317140 (Il6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110317140 (Il6)
   04931 Insulin resistance
    110317140 (Il6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110317140 (Il6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110317140 (Il6)
   01523 Antifolate resistance
    110317140 (Il6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110317140 (Il6)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Interleukins
   110317140 (Il6)
SSDB
Motif
Pfam: IL6 IL23
Other DBs
NCBI-GeneID: 110317140
NCBI-ProteinID: XP_021047197
Ensembl: MGP_PahariEiJ_G0021821
LinkDB
Position
2
AA seq 211 aa
MKFLSARDFHPVAFLGLMLVTTTAFPTSQVRRGDFTEDTTPNRPVYTTSQVGGLITQVLR
EILAMRKELCNGNPDCMNNDDALSENNLKLPEIQRNDGCFQTGYNQEICLLKITSGLLEY
QIYLEYMKNNLKDNKKDKARVIQRDTETLIYIFNQEVKDLYKIVLPSPISDPLLMEKMES
QKEWLRTKTIQFILKALEEFLKVTLRSTRQT
NT seq 636 nt   +upstreamnt  +downstreamnt
atgaagttcctctctgcaagagacttccatccagttgccttcttgggactgatgctggtg
acaaccacggccttccctacttcacaagtccggagaggagacttcacagaggacaccact
cccaacagaccagtatacaccacttcacaagtcggaggcttaattacacaagttctcagg
gaaatcttggcaatgagaaaagagttgtgcaatggcaatcctgattgtatgaacaacgat
gatgcactttcagaaaacaatctgaaacttccagagatacaaagaaatgatggatgcttc
caaactggatacaatcaggaaatttgcctattgaaaattacctctggtcttctggagtac
caaatctacctggagtacatgaagaacaacttaaaagataacaagaaagacaaagccaga
gtcattcagagagatacagaaaccctaatttatatcttcaatcaagaggtaaaagattta
tataaaatagtccttcctagcccaatttccgatcctctcctaatggagaagatggagtca
cagaaggagtggctaaggaccaagaccatccaattcatcttgaaagcacttgaagaattt
ctaaaagtcactttgagatctactcggcaaacctag

DBGET integrated database retrieval system