KEGG   Mus pahari (shrew mouse): 110318522
Entry
110318522         CDS       T05929                                 

Symbol
Thbd
Name
(RefSeq) thrombomodulin
  KO
K03907  thrombomodulin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110318522 (Thbd)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110318522 (Thbd)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110318522 (Thbd)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mpah04090]
    110318522 (Thbd)
   00535 Proteoglycans [BR:mpah00535]
    110318522 (Thbd)
   04091 Lectins [BR:mpah04091]
    110318522 (Thbd)
CD molecules [BR:mpah04090]
 Proteins
  110318522 (Thbd)
Proteoglycans [BR:mpah00535]
 Cell surface proteoglycans
  Others
   110318522 (Thbd)
Lectins [BR:mpah04091]
 C-Type lectins
  Group 14: Thrombomodulin
   110318522 (Thbd)
SSDB
Motif
Pfam: FXa_inhibition Tme5_EGF_like cEGF Lectin_C EGF_CA EGF
Other DBs
NCBI-GeneID: 110318522
NCBI-ProteinID: XP_021049300
Ensembl: MGP_PahariEiJ_G0025849
LinkDB
Position
3
AA seq 579 aa
MLGIFFLGVLAPASLGLSALAKLQPTGSQCVEHECFALFQGPVTFLDASQACQRLQGHLM
TVRSSVAADVISLLLSQSSMRSQPWIGLQLPQGCGDPVHLGPLRGFQWVTGDNHTSYSRW
ARPNDQSAPLCGPLCVTVSTATETASGEPAWEEKPCETETESFLCEFYFTASCRPLTVNT
RDPETAHISSTYNTPFGVSGADFQTVPVGSSAAVEPLGLELVCRAPPGTSEGHWAREATG
AWNCSVENGGCEYLCNRSTNEPRCLCPNDMDLQADGRSCARPVVQSCNELCEHFCVSNAE
VPGSYSCMCETGYQLAADGHRCEDVDDCKQGPNPCPQLCVNTKGGFECFCYEGYELVDGE
CVELLDPCFGSNCEFQCQPVSSTEYRCICAPGFAPKPDEPHKCEMFCNETSCPADCDPNS
PTVCECPEGFILDDGSICTDIDECSQDECSPSECRNFPGSYECICGPDTALAGQISKECD
PTPVREDTYTKDEEGSGEPPVSPTPASPTGPPSARPVHSGVLIGISIASLSLVVALLALL
CHLRKKQGAARAELEYKCASSAKEVVLQHVRTDRTLQKF
NT seq 1740 nt   +upstreamnt  +downstreamnt
atgcttgggattttctttctgggtgtgctggctccagctagcctggggctctccgcacta
gccaagctgcagcccacaggcagtcaatgcgtggagcacgagtgcttcgcgcttttccag
ggccccgtgaccttcctcgatgccagccaggcctgccagcgcctgcaaggacatttgatg
acagtgcgctcctcagtggctgccgatgtcatctcccttctgctgagccagagcagtatg
cgctcacagccctggatcggtttacagctcccgcagggctgtggcgacccggtgcatctc
gggcccctgcgcggcttccagtgggttactggggataaccacaccagttacagcaggtgg
gcgcggcccaacgaccagtcggctccactctgtggcccgctgtgcgtcacggtctcgaca
gcaacagaaactgcatcgggcgagccggcctgggaagagaagccatgcgagaccgagacc
gagagtttcctctgcgagttttacttcacagcttcctgcaggcctctgacggtgaatacc
cgcgatcctgagactgcccatatctctagtacctacaacaccccgttcggggtcagtggt
gcggactttcaaacggtgccggtaggcagttctgctgcggtggagccccttggcttggag
ctggtgtgcagggcccctcccggaacttcagagggacactgggctcgggaagcgacagga
gcctggaactgcagcgtggagaatggtggctgcgagtacttgtgcaataggagcacgaat
gaaccccgatgcctctgccccaacgacatggacctgcaggccgatggacgttcgtgcgca
agacctgtggttcaatcgtgcaacgaactctgcgagcatttttgcgtcagcaacgctgaa
gtgccaggctcttactcctgtatgtgtgaaacaggctaccagttggctgcagatggacac
cggtgtgaggacgtggatgactgtaagcaggggcccaatccatgcccccagctctgtgtt
aacaccaagggcggcttcgaatgcttctgctatgaaggctatgaattggtggatggagag
tgcgtggagctcctggatccgtgtttcggatctaactgcgagtttcagtgtcagccagtg
agctctacagagtaccgttgcatctgtgctccgggtttcgcacccaagccggatgaaccg
cacaagtgcgaaatgttctgcaatgaaacttcgtgcccagcagactgtgaccctaactcc
cctactgtttgtgaatgccctgaaggcttcatcctggacgacggttccatatgcacggac
attgatgagtgcagtcaagatgaatgctcccccagtgaatgtcgaaactttcctggctcc
tatgagtgcatctgcggacctgacacagcccttgctggtcagattagtaaggagtgtgac
cccacccctgttagggaagacacctacaccaaggacgaggagggctctggggaacctcca
gtcagccctacgccagcctctccgacaggccccccttctgcaaggccagtgcattctggc
gtgctcattggcatctccattgccagcctgtccctggtggtggcgcttttggcgcttctc
tgtcacctgcgcaagaagcagggcgctgctcgcgcagagctggagtacaagtgcgcatct
tccgccaaggaggtagtgctgcagcacgtgaggactgatcggactctgcagaagttctga

DBGET integrated database retrieval system