KEGG   Mus pahari (shrew mouse): 110319929
Entry
110319929         CDS       T05929                                 

Gene name
Pak1
Definition
(RefSeq) serine/threonine-protein kinase PAK 1
  KO
K04409  p21-activated kinase 1 [EC:2.7.11.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04010  MAPK signaling pathway
mpah04012  ErbB signaling pathway
mpah04014  Ras signaling pathway
mpah04024  cAMP signaling pathway
mpah04062  Chemokine signaling pathway
mpah04360  Axon guidance
mpah04392  Hippo signaling pathway - multiple species
mpah04510  Focal adhesion
mpah04625  C-type lectin receptor signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah04660  T cell receptor signaling pathway
mpah04666  Fc gamma R-mediated phagocytosis
mpah04810  Regulation of actin cytoskeleton
mpah05132  Salmonella infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05205  Proteoglycans in cancer
mpah05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110319929 (Pak1)
   04012 ErbB signaling pathway
    110319929 (Pak1)
   04014 Ras signaling pathway
    110319929 (Pak1)
   04392 Hippo signaling pathway - multiple species
    110319929 (Pak1)
   04024 cAMP signaling pathway
    110319929 (Pak1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110319929 (Pak1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110319929 (Pak1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110319929 (Pak1)
   04650 Natural killer cell mediated cytotoxicity
    110319929 (Pak1)
   04660 T cell receptor signaling pathway
    110319929 (Pak1)
   04666 Fc gamma R-mediated phagocytosis
    110319929 (Pak1)
   04062 Chemokine signaling pathway
    110319929 (Pak1)
  09158 Development and regeneration
   04360 Axon guidance
    110319929 (Pak1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    110319929 (Pak1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    110319929 (Pak1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110319929 (Pak1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110319929 (Pak1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110319929 (Pak1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110319929 (Pak1)
   03036 Chromosome and associated proteins [BR:mpah03036]
    110319929 (Pak1)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110319929 (Pak1)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: STE group
  STE20 family
   110319929 (Pak1)
Membrane trafficking [BR:mpah04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    110319929 (Pak1)
 Endocytosis
  Macropinocytosis
   Kinases
    110319929 (Pak1)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     110319929 (Pak1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD ABC1 Kinase-like Pkinase_fungal DSHCT APH Kdo
Other DBs
NCBI-GeneID: 110319929
NCBI-ProteinID: XP_021051324
Ensembl: MGP_PahariEiJ_G0013230
LinkDB
Position
1
AA seq 544 aa
MSNNGVDIQDKPPAPPMRNTSTMIGAGSKDTGTLNHGSKPLPPNPEEKKKKDRFYRSILP
GDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKN
PQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNTLNVKTVSETPAVPPVSEDEDDD
DDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEK
QKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQM
NLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCM
DEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKR
STMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGT
PELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEAT
KNNH
NT seq 1635 nt   +upstreamnt  +downstreamnt
atgtcaaataacggcgtagacatccaggacaaacccccagcccctccaatgagaaacacc
agcactatgattggagccggcagcaaagacactggaaccttaaaccacggctccaaacct
ctgcctccaaacccagaggagaagaaaaagaaggaccggttctatcgatccatcttacct
ggagataaaacaaataaaaagaaggagaaggagcgaccagagatttctcttccttcagat
tttgagcatacaattcatgtcggttttgatgctgtcacaggggagtttacgggaatgcca
gaacagtgggcccgcttgcttcaaacatcaaatatcacaaagtcagagcagaagaaaaac
ccacaggctgttctggatgtgttggaattttataactctaagaagacctccaatagtcag
aagtacatgagttttacagataagtcagctgaagattataattcttctaacactttgaat
gtgaagactgtgtctgagactccagcagtaccaccagtgtcagaagatgaagatgatgat
gacgatgctaccccacctccagtgattgctccacgcccagaacacacaaaatctgtatat
acacgatctgtgattgaaccacttcctgttactccaactcgggatgtggctacatctcct
atttctcctactgagaataacaccactccgccagatgctttgacccggaacactgaaaaa
caaaagaagaagcctaaaatgtctgatgaggagatcttagagaaattacggagcatagtg
agtgtgggtgatcctaagaagaagtacacacggttcgagaagattggacaaggtgcttca
ggcacagtgtatactgcaatggatgtagccacagggcaggaggtggccattaaacagatg
aatcttcagcagcagccgaagaaagagctgattattaatgagatcctggtcatgagggaa
aacaaaaacccaaatattgtcaactacctggacagttaccttgtgggagatgagctatgg
gttgtcatggagtacttggctggaggctccttgacagatgtggtgacagaaacctgtatg
gatgaaggccagatagcagctgtgtgccgagagtgtctacaagctttggagtttctacat
tcgaaccaagtcattcacagggacatcaagagtgacaatattctgctgggaatggatggc
tctgtcaagttaactgactttggattctgtgcacagataactccagagcagagcaaaagg
agcaccatggtgggaactccttattggatggcacctgaagttgtgacacgcaaggcttat
ggacccaaggttgacatctggtccctcggtattatggcaattgaaatgattgagggggag
cccccatacctcaatgaaaaccctttgagagccttgtacctcattgctaccaatgggacg
ccagagcttcagaacccagagaagttgtcagctattttccgggactttttgaaccgctgt
cttgagatggatgtggagaagagaggttcagctaaagagctcctgcagcatcagttcctg
aagattgccaagcccctctctagcctgactccactgattgctgcagcaaaagaggcaacc
aagaacaatcactga

DBGET integrated database retrieval system