Mus pahari (shrew mouse): 110321591 Help Entry 110321591         CDS       T05929                                  Symbol Bcl2 Name (RefSeq) apoptosis regulator Bcl-2   KO K02161   apoptosis regulator Bcl-2 Organism mpah  Mus pahari (shrew mouse) Pathway mpah01521   EGFR tyrosine kinase inhibitor resistance mpah01522   Endocrine resistance mpah01524   Platinum drug resistance mpah04064   NF-kappa B signaling pathway mpah04066   HIF-1 signaling pathway mpah04071   Sphingolipid signaling pathway mpah04115   p53 signaling pathway mpah04140   Autophagy - animal mpah04141   Protein processing in endoplasmic reticulum mpah04151   PI3K-Akt signaling pathway mpah04210   Apoptosis mpah04215   Apoptosis - multiple species mpah04217   Necroptosis mpah04261   Adrenergic signaling in cardiomyocytes mpah04340   Hedgehog signaling pathway mpah04510   Focal adhesion mpah04621   NOD-like receptor signaling pathway mpah04630   JAK-STAT signaling pathway mpah04722   Neurotrophin signaling pathway mpah04725   Cholinergic synapse mpah04915   Estrogen signaling pathway mpah04928   Parathyroid hormone synthesis, secretion and action mpah04933   AGE-RAGE signaling pathway in diabetic complications mpah05014   Amyotrophic lateral sclerosis mpah05022   Pathways of neurodegeneration - multiple diseases mpah05132   Salmonella infection mpah05145   Toxoplasmosis mpah05152   Tuberculosis mpah05161   Hepatitis B mpah05162   Measles mpah05168   Herpes simplex virus 1 infection mpah05169   Epstein-Barr virus infection mpah05170   Human immunodeficiency virus 1 infection mpah05200   Pathways in cancer mpah05206   MicroRNAs in cancer mpah05207   Chemical carcinogenesis - receptor activation mpah05210   Colorectal cancer mpah05215   Prostate cancer mpah05222   Small cell lung cancer mpah05226   Gastric cancer mpah05417   Lipid and atherosclerosis mpah05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mpah00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     110321591 (Bcl2)  09130 Environmental Information Processing   09132 Signal transduction    04340 Hedgehog signaling pathway     110321591 (Bcl2)    04630 JAK-STAT signaling pathway     110321591 (Bcl2)    04064 NF-kappa B signaling pathway     110321591 (Bcl2)    04066 HIF-1 signaling pathway     110321591 (Bcl2)    04071 Sphingolipid signaling pathway     110321591 (Bcl2)    04151 PI3K-Akt signaling pathway     110321591 (Bcl2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     110321591 (Bcl2)   09143 Cell growth and death    04210 Apoptosis     110321591 (Bcl2)    04215 Apoptosis - multiple species     110321591 (Bcl2)    04217 Necroptosis     110321591 (Bcl2)    04115 p53 signaling pathway     110321591 (Bcl2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     110321591 (Bcl2)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     110321591 (Bcl2)   09152 Endocrine system    04915 Estrogen signaling pathway     110321591 (Bcl2)    04928 Parathyroid hormone synthesis, secretion and action     110321591 (Bcl2)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     110321591 (Bcl2)   09156 Nervous system    04725 Cholinergic synapse     110321591 (Bcl2)    04722 Neurotrophin signaling pathway     110321591 (Bcl2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110321591 (Bcl2)    05206 MicroRNAs in cancer     110321591 (Bcl2)    05207 Chemical carcinogenesis - receptor activation     110321591 (Bcl2)   09162 Cancer: specific types    05210 Colorectal cancer     110321591 (Bcl2)    05226 Gastric cancer     110321591 (Bcl2)    05215 Prostate cancer     110321591 (Bcl2)    05222 Small cell lung cancer     110321591 (Bcl2)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     110321591 (Bcl2)    05161 Hepatitis B     110321591 (Bcl2)    05162 Measles     110321591 (Bcl2)    05168 Herpes simplex virus 1 infection     110321591 (Bcl2)    05169 Epstein-Barr virus infection     110321591 (Bcl2)   09171 Infectious disease: bacterial    05132 Salmonella infection     110321591 (Bcl2)    05152 Tuberculosis     110321591 (Bcl2)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     110321591 (Bcl2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     110321591 (Bcl2)    05022 Pathways of neurodegeneration - multiple diseases     110321591 (Bcl2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     110321591 (Bcl2)    05418 Fluid shear stress and atherosclerosis     110321591 (Bcl2)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     110321591 (Bcl2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     110321591 (Bcl2)    01524 Platinum drug resistance     110321591 (Bcl2)    01522 Endocrine resistance     110321591 (Bcl2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mpah01009]     110321591 (Bcl2) Protein phosphatases and associated proteins [BR:mpah01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      110321591 (Bcl2) BRITE hierarchyBRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  110321591 NCBI-ProteinID:  XP_021053579 Ensembl:  MGP_PahariEiJ_G0027722 LinkDB All DBs Position 5:complement(82551341..82719531) Genome browser AA seq 236 aa AA seqDB search MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADSAPRGAAPTPGVFSFQPESNPTPA VHRDTAARTSPLRPLIATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTP FTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNR HLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK NT seq 711 nt NT seq  +upstreamnt  +downstreamnt atggcgcaagccgggagaacagggtatgataaccgggagatcgtgatgaagtacatacat tataagctgtcacagaggggctacgagtgggatgctggagatgcggactcggcgccccgg ggagctgcccccacccctggcgtcttctccttccagcctgagagcaacccaacgcccgct gtgcaccgggacacggctgccaggacatctcctctacggcccctcattgccaccgctggg cctgcgctcagccctgtgccacctgtggtccacctgaccctccgccgggctggggatgac ttctctcgtagataccgtcgtgacttcgcagagatgtccagtcagctgcacctgacgccc ttcaccgcgaggggacgctttgccacggtggtggaggaactcttcagggatggggtgaac tgggggaggattgtggccttctttgagttcggtggggtcatgtgtgtggagagcgtcaac agggagatgtcacccctggtggacaacatcgccctgtggatgactgagtacctgaaccgg catctgcacacctggatccaggataacggaggctgggatgcctttgtggagctgtatggc cccagcatgcgacctctgtttgatttctcctggctgtctctgaagaccctgctcagcctg gccctggtcggggcctgcatcactctgggtgcatacctgggccacaagtga

DBGET integrated database retrieval system