KEGG   Mus pahari (shrew mouse): 110321620
Entry
110321620         CDS       T05929                                 
Symbol
Cr2
Name
(RefSeq) complement receptor type 2
  KO
K04012  complement receptor type 2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
mpah04640  Hematopoietic cell lineage
mpah04662  B cell receptor signaling pathway
mpah05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110321620 (Cr2)
   04610 Complement and coagulation cascades
    110321620 (Cr2)
   04662 B cell receptor signaling pathway
    110321620 (Cr2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    110321620 (Cr2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mpah04090]
    110321620 (Cr2)
CD molecules [BR:mpah04090]
 Proteins
  110321620 (Cr2)
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 110321620
NCBI-ProteinID: XP_021053630
Ensembl: MGP_PahariEiJ_G0028308
LinkDB
Position
5:complement(166930406..166972696)
AA seq 1033 aa
MGALGSLWVFFTLITPGVLEISCDPPPEVKNARKLYYSLPIIPGTVVRYTCSPSYRLIGE
KAIFCISKDQVNATWDKAPPICESVNKIISCSEPIVPGGFINKGSRPPFRHGDSVTFTCK
ANFTMKGSKTVWCQANKMWGPTALPVCESDFPLECPSLPTIHNGHHTGQNVDQFVAGLSV
TYSCEPGYLLIGKKTIKCLSSGDWDGVIPTCKEAQCEHPGMFPNGQVKEPLSLQVGATVY
FSCNKGYQLQGQHSSQCVIVEQKAIWTKKPVCKEILCPPPPPVRNGRHSGSSSENVPYGS
TVTYTCDPSPEKGVNFTLIGEKTISCTTGSQKTGIWSGPAPYCELSTSAVQCLQPQINRG
KMLSILKDSYSYNDTVAFSCEPGFTLKGSRSIRCNAHSTWEPPVPVCEKGCQAPPKIING
QKEDSYMLNFDPGASIKYSCDPGYLLVGEDTIHCTPEGKWTPIPPQCTVAECKPVGPHLF
KRPQNQFIRTAVNSSCDEGFQLSESAYQLCQGTIPWFIEIHLCKEITCPPPPVIHDGTHT
WSSSEDVPYGTVVTYMCYPGPEEGVKFKLIGEQTIHCTSDSRGRGSWSSPAPLCKLSLPA
VQCADVHVANGVKLTDNEAPYSYNDSVIFKCHNGYILSGSSQIRCKANNTWDPEKPLCKK
EGCEPMRELHDLPDDSHIKLVNRTCQNGYQLTGHTYEKCQNAENGTWFQKIAVCTVILCQ
PPPTIANGSHTGMMAKHFLYGNEVSYECDKGFYLLGEKSLQCINDSKGHGSWSGPPPQCL
QSSPLTHCPDPEVKHGYKLNKTHSAYSHNDIVHFACNQGFIMNGSHLIRCHTNNTWLPGV
PTCIRKASLGCQSPSTIPNGNHTGGNIARFSPGMSVMYSCYQGFLMAGEARLICTHEGTW
SQPPPFCKEVNCSFPEDINGIQKGFQPGKTYRFGATVTLECEDGYTLEGSPQSQCQDDNQ
WNPPLAICKYQSTIPLICGISAGSALIILISVSFCMILKPRESNYHTRTRPKEGALHLET
REVYSIDPYNPAS
NT seq 3102 nt   +upstreamnt  +downstreamnt
atgggagccttgggttcgctctgggttttcttcactctcatcactccaggagttcttgag
atttcttgtgaccctcctcctgaagtcaaaaatgctcggaaactctattattctcttccc
ataattcctggaactgttgtgaggtacacttgttcacctagctaccgcctcatcggagaa
aaggctatcttttgtataagtaaagatcaagtgaatgccacctgggataaagctcctcct
atatgtgaatctgtgaataaaatcatttcttgctcagaacccatagtaccagggggattc
ataaataaaggatctagaccaccattcagacatggtgattctgtgacatttacctgtaaa
gccaacttcaccatgaaaggaagcaaaactgtctggtgccaggcaaataaaatgtgggga
ccaacagcactgccagtctgtgagagtgatttccctctggaatgcccatcacttccaacg
attcataatggacaccacacaggacagaatgttgaccagtttgttgcggggttgtctgtg
acatacagttgtgaacctggctatttgcttattggaaaaaagacaattaagtgcttatct
tcaggagactgggatggcgtcatccctacatgcaaagaggcccagtgtgaacatccagga
atgtttcccaatgggcaggtaaaagagcctctgagtcttcaggttggtgcaactgtgtac
ttctcctgtaataaagggtaccaattacaaggacaacactctagtcagtgtgtaattgtt
gaacagaaagccatctggactaagaagccagtatgtaaagaaattctctgcccaccacct
ccacctgttcgtaacggaagacattcaggcagctcttcagaaaatgtaccatatggaagc
acagttacctacacctgtgacccaagcccagagaaaggagtgaacttcactcttattgga
gagaagactatctcttgtactaccggtagtcagaagactggcatctggagcggccctgct
ccatattgtgaactttcaacttctgcagttcagtgtctacaaccccagatcaatagaggg
aagatgttatctattttgaaagatagttattcatataatgacactgtggcattttcttgt
gaacctggcttcaccttgaagggcagcaggagcattcgatgtaatgcccatagcacatgg
gagccaccggtaccagtgtgtgaaaaaggatgtcaggctcctcctaaaatcatcaatggg
caaaaagaagatagttacatgctcaactttgaccctggtgcatccataaaatacagctgt
gaccctggctatttactggtgggagaggacactatacactgtacccctgaggggaagtgg
acacccattcccccccagtgcacagttgcagagtgtaagccagtagggccacatctcttt
aaaaggcctcagaatcagtttattaggacagctgttaattcttcttgtgatgaagggttc
cagttaagtgagagtgcttatcaactgtgtcaaggtacaattccttggtttatagaaatc
catctttgtaaagaaatcacctgcccaccacctcctgttatccacgacgggacacataca
tggagttcctcagaagatgtcccatatggaactgtggtcacatacatgtgctatcctggg
ccagaggaaggagtaaaattcaaactcattggggagcaaaccatccactgtacaagtgac
agcagaggaagaggctcctggagtagccctgctcctctctgtaaactttccctcccagct
gtccagtgcgcagacgttcatgttgcaaatggagtcaagctcactgacaatgaagccccg
tattcctacaatgatagtgtgatattcaagtgccataatggatacattttgagtggaagc
agtcagatccggtgtaaagccaataatacctgggatcctgaaaaaccactttgtaaaaaa
gaagggtgtgagcctatgagagagctgcatgaccttccagatgattcacatataaaacta
gtgaatagaacttgtcaaaatgggtaccagttgactggacatacttatgagaagtgtcaa
aatgctgagaatgggacttggtttcaaaagattgcagtttgtacagttattctctgccaa
cctccgccaacaattgcaaatggtagtcacacaggcatgatggcaaagcacttcctatat
ggaaacgaagtttcatatgaatgtgataaagggttctatcttttgggagagaaaagtttg
cagtgcataaatgattctaaaggtcatggatcttggagtggacctccaccacaatgctta
caatcttctcctctaactcattgccctgatccagaagtcaaacatggttacaaactcaat
aaaactcattctgcatattctcataatgacatagtacattttgcctgcaatcaaggcttc
atcatgaacggcagccacttgataaggtgtcatactaataacacatggttaccaggtgta
ccaacttgtatcagaaaagcttctttagggtgtcagtctccatccacaatccccaatggg
aatcatactggtgggaatatagctcgattttcccctggaatgtcagtcatgtacagttgt
taccaaggcttccttatggctggagaggcacgtcttatctgtactcatgagggtacctgg
agccaacctccccctttttgcaaagaggtaaactgtagcttccctgaagatataaatgga
atccagaagggatttcaacctgggaaaacctatcggtttggagctactgtgactctggaa
tgtgaggatgggtataccttggagggaagtccacagagccagtgccaggatgacaaccaa
tggaaccctcctctggctatctgcaaataccagtcaactattcctcttatttgtggtatt
tctgcaggctcagcacttatcattttgattagtgtcagcttctgtatgatattaaaaccc
agagaaagcaattatcatacaaggacaagacccaaagaaggagctcttcatttagaaaca
cgagaagtatattctattgatccatacaacccagcaagctga

DBGET integrated database retrieval system