KEGG   Mus pahari (shrew mouse): 110321703
Entry
110321703         CDS       T05929                                 
Symbol
Ptprc
Name
(RefSeq) receptor-type tyrosine-protein phosphatase C isoform X1
  KO
K06478  receptor-type tyrosine-protein phosphatase C [EC:3.1.3.48]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04660  T cell receptor signaling pathway
mpah04666  Fc gamma R-mediated phagocytosis
mpah05132  Salmonella infection
mpah05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110321703 (Ptprc)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    110321703 (Ptprc)
   04666 Fc gamma R-mediated phagocytosis
    110321703 (Ptprc)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110321703 (Ptprc)
  09163 Immune disease
   05340 Primary immunodeficiency
    110321703 (Ptprc)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mpah01009]
    110321703 (Ptprc)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mpah04090]
    110321703 (Ptprc)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     110321703 (Ptprc)
Protein phosphatases and associated proteins [BR:mpah01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    110321703 (Ptprc)
CD molecules [BR:mpah04090]
 Proteins
  110321703 (Ptprc)
SSDB
Motif
Pfam: Y_phosphatase CD45 fn3 PTP_N Y_phosphatase3 PTPlike_phytase DSPc DUF2207 TM231 Myotub-related GnsAB_toxin
Other DBs
NCBI-GeneID: 110321703
NCBI-ProteinID: XP_021053782
Ensembl: MGP_PahariEiJ_G0027896
LinkDB
Position
5:complement(112269885..112384093)
AA seq 1288 aa
MTMGLWLKLLAFGFALLDTEVFVTGQTPIPTPSDGLSTTEKALPLPQTDPLPARTTESTP
PSISERGNGSSETTYHPGVLSTLLPHLSPQPDSQTPSARGADTQTLSSQADIPTLMPAPG
GGTDPPGVRGERTVPGTIPADTALPADTPSLARNSSAASPTHTSNISTTDIASGANLTAL
TPSTPSFASTDPPSTTIATTKKSSCDAIFGDIPVIYTYESSNRTFKADLKDVKNAKCGSE
DCEKVLKNLTECSLKSVNVSNDSCDPAKTLHLYVPPGTDKFSLHDCTPNEKANTSICLEW
KTEDLTVLNCDSEKISYKFHCKLENKTCNGRPGTFKPEIYQLDNLSAQTNYTCEAKILYN
NTEFFETVTTVQTDLGNPETPKPRCDDPTKRTALVTWPEPASKPHGYVLCYKNNSEKCES
LPNNVTRFEVKSLKPYRNYEASLLAYVNGKIQRNGTAEKCKFQTKADRPDKVTGMKTSRV
TDNSINVTCGLPYETNGPKIFYILEVKIGGSVVKSDNKSTCQFYVDNLYYSTDYEFRVYF
HNGEYRGDPVIRKHSTSYNSKALIIFLVFLIIVTSIALFVVLYKIYDLRKKRSSNLDEQQ
ELVERDDEKQLMDVEPIHSDILLETYKRKIADEGRLFLAEFQSIPRVFSRFHIKDARKPH
NQNKNRYVDILPYDYNRVELSEINGDAGSTYINASYIDGFKEPRKYIAAQGPRDETVDDF
WRMIWEQKATVIVMVTRCEEGNRNKCAEYWPCMEEGTRAFRDIVVTINDHKRCPDYIIQK
LNISHKKEKATGREVTHIQFTSWPDHGVPEDPHLLLKLRRRVNAFSNFFSGPIVVHCSAG
VGRTGTYIGIDAMLEGLEAEGKVDVYGYVVKLRRQRCLMVQVEAQYILIHQALVEYNQFG
ETEVNLSELHSCLQNMKKRDPPSDPSPLEAEYQRLPSYRSWRTQHVGNQEENKKKNRNSN
VVPYDFNRVPLKHELEMSKESEPESDESSDDDSDSEETSKYINASFVMSYWKPEMMIAAQ
GPLKETIGDFWQMIFQRKVKVIVMLTELMNGDQEVCAQYWGEGKQTYGDMEVEVKDTTRA
SAYTLRTFELRHSKRKEPRTVYQYQCTTWKGEELPAEPKDLVSMIQNLKQKLPKSCPEGM
KYHKHTSVLVHCRDGAQQTGLFCALFNLLESAETEDVVDVFQVVKSLRKARPGVVSSYEQ
YQFLYDTIASIYPAQNGQVKKTNSQDKIEFHNEVDGGKQDANCVSPAGSLNKAQEDSKGM
GASEPTNSAEEPEHAANGPASPAPTQSS
NT seq 3867 nt   +upstreamnt  +downstreamnt
atgaccatgggtttgtggctcaaacttctggcctttggctttgcccttctggacacagaa
gtctttgtcacagggcaaacccctatacctacacccagtgatggactgagcacaacagag
aaggcccttcctctgcctcaaactgaccccttacctgctcgcaccactgaatccacaccc
ccaagcatctctgaaagaggaaatggctcttcagagaccacatatcatccaggtgtttta
tccacgctgctgcctcacctgtccccacagcctgactcgcagacgccctctgccagagga
gctgacactcagacactcagcagccaagctgacatccccacactcatgcctgctcccggc
ggcgggactgacccaccaggtgtgcgaggggagaggactgtaccagggaccattcctgca
gacacagcccttcctgctgacacccccagccttgcacgcaacagctctgctgcctcacct
acacacacctccaatatcagcaccacagatatcgcctcaggtgccaacctcacagccctt
acaccatccactccgagctttgcaagcactgaccctccaagcacaaccatagctaccaca
aagaagtcatcatgtgatgcaatatttggggacattcctgtgatttacacctatgaatct
agtaatcggacttttaaggcagacctaaaagatgtcaaaaatgctaagtgtggaagtgag
gattgtgaaaaagtgttaaaaaatctaacagaatgctcactgaaaagcgtcaatgtgtct
aatgactcatgtgatccagctaaaactttacatttatatgtaccaccagggactgacaag
ttttcgctacatgactgcacaccaaatgaaaaagctaatacttcaatttgtttggagtgg
aaaacagaagaccttactgtcctaaactgcgacagtgaaaaaatttcatataaattccac
tgtaagctagaaaataaaacatgcaatggaagacctggtacattcaaacctgaaatatat
cagttagacaaccttagtgcccaaacaaattacacatgtgaagcaaaaatcttatataac
aacacagaattcttcgaaactgttacaaccgtgcagacagatttggggaatccagaaacg
cctaagcctaggtgtgatgatccaactaagagaacagcgttagtcacttggcccgagcct
gcatctaaaccccatggatatgttttatgctataagaacaattcagaaaaatgtgaaagt
ttgcctaataatgtgaccaggtttgaggtgaaaagcttgaaaccttatagaaactatgaa
gcatccctacttgcctatgtcaatgggaagattcaacgaaatgggactgctgagaagtgc
aagtttcagacaaaagcagatcgtccagacaaggtcactgggatgaaaacctcccgggtg
acagacaatagtataaatgtcacatgtggtcttccttatgaaactaatggccctaaaatc
ttttacattttggaagtcaaaattggaggttctgttgttaaaagtgacaacaagtcaaca
tgtcagttttatgtagataatctctactattcaactgactatgaatttcgggtctatttt
cacaatggagagtaccggggagatccagttataagaaagcattcaacatcttataattct
aaagcactgattatattcctggtgtttctgattattgtgacatcaatagccctgtttgtt
gttttgtataaaatctatgatctgcgcaaaaaaagatccagcaatttagatgaacaacag
gaacttgttgaaagggatgatgaaaagcagctgatggatgtggagccaattcattctgac
attttgttggaaacatacaaaaggaagattgctgacgagggcagactgttcttggctgaa
tttcagagcattccacgggtattcagcaggtttcacatcaaagatgccagaaagccccac
aatcagaataaaaaccgttatgttgacattcttccctatgattataaccgtgtggagctc
tcggaaataaatggagatgcagggtccacctacataaatgccagctacattgatggcttc
aaggaacccaggaaatacattgctgcacaagggccccgggacgaaacagttgatgacttc
tggaggatgatctgggagcaaaaggccacagttattgtcatggtcacacgatgtgaagaa
ggaaacaggaacaagtgtgcagaatactggccatgcatggaggaaggcactcgggctttc
agagatattgttgtgaccatcaatgaccacaaacgatgtcctgattacatcattcagaag
ctgaacatttcacataaaaaagaaaaagcaactggaagagaagtgactcatatccagttc
accagctggccagaccatggggttcctgaagaccctcacctgctcctcaaacttcgacgg
agagttaatgcttttagcaacttcttcagtggtcccattgtggtgcactgcagtgctggt
gttggacgtacaggcacctacattggaattgatgccatgctggaaggcctggaagcagag
ggcaaagtggatgtctatggttatgttgtcaagctaaggcgacagaggtgtttgatggtg
caagtggaggcacagtacatcctgattcatcaggctttagtggaatacaatcagtttggt
gaaacagaagtgaacttgtctgagttacattcatgcctacagaacatgaagaagagagac
ccacccagtgacccctctcctctggaggctgaataccagagacttccatcatacaggagc
tggaggacacagcacgttggaaatcaagaagaaaataagaagaaaaacaggaattctaat
gttgttccatatgactttaacagggtgccgcttaagcatgaactagagatgagcaaagag
agcgagcctgagtcagatgagtcctcagatgatgacagtgactcagaggaaaccagcaaa
tacattaatgcatcctttgtgatgagttactggaaaccagaaatgatgattgctgctcag
gggccactaaaagaaacaatcggtgatttttggcagatgatattccaaagaaaagtcaaa
gttattgtgatgttgacagagttaatgaatggagaccaggaagtctgtgctcagtactgg
ggagagggaaagcagacttatggagacatggaagtggaggtgaaagacacaaccagagcc
tcagcctacactctccgaaccttcgagctgagacattccaagaggaaggagcccagaact
gtgtaccagtaccagtgtaccacatggaaaggggaagagctccctgcagaaccgaaagac
ctggtgtcgatgattcagaacctcaaacagaagcttcccaagagttgcccagaagggatg
aagtatcacaagcatacatcagtcctcgtccactgcagagatggagcccagcagacaggg
ttgttctgtgccttgttcaatctcttggaaagtgcagaaacagaagatgtggttgatgtt
tttcaagtggtaaagtctctacgcaaagcacggcctggggtggtgagcagctatgagcaa
taccagttcctctatgacaccatcgccagcatctatcctgcccagaatggacaagtgaag
aaaacaaacagccaagacaaaattgaatttcataatgaagtggacggaggcaagcaggat
gctaactgcgtcagcccagctggttctctgaacaaagcccaggaagacagcaaagggatg
ggagcttcggagcctaccaatagtgctgaggagccagaacatgctgccaatggtcctgcg
agcccagctccaacccagagttcatag

DBGET integrated database retrieval system