KEGG   Mus pahari (shrew mouse): 110322470
Entry
110322470         CDS       T05929                                 
Symbol
Cd28
Name
(RefSeq) T-cell-specific surface glycoprotein CD28
  KO
K06470  CD28 antigen
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04660  T cell receptor signaling pathway
mpah04672  Intestinal immune network for IgA production
mpah04940  Type I diabetes mellitus
mpah05162  Measles
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mpah05320  Autoimmune thyroid disease
mpah05322  Systemic lupus erythematosus
mpah05323  Rheumatoid arthritis
mpah05330  Allograft rejection
mpah05332  Graft-versus-host disease
mpah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110322470 (Cd28)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    110322470 (Cd28)
   04672 Intestinal immune network for IgA production
    110322470 (Cd28)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110322470 (Cd28)
  09172 Infectious disease: viral
   05162 Measles
    110322470 (Cd28)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    110322470 (Cd28)
   05323 Rheumatoid arthritis
    110322470 (Cd28)
   05320 Autoimmune thyroid disease
    110322470 (Cd28)
   05330 Allograft rejection
    110322470 (Cd28)
   05332 Graft-versus-host disease
    110322470 (Cd28)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110322470 (Cd28)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110322470 (Cd28)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mpah04090]
    110322470 (Cd28)
CD molecules [BR:mpah04090]
 Proteins
  110322470 (Cd28)
SSDB
Motif
Pfam: V-set_2 V-set Raffinose_syn Ly49
Other DBs
NCBI-GeneID: 110322470
NCBI-ProteinID: XP_021054806
Ensembl: MGP_PahariEiJ_G0027429
LinkDB
Position
5:39949728..39975164
AA seq 219 aa
MTLRLLFLALNFFSSVQVTENKILVKQSPLLVVDSNEVSLSCRYSYNLLAKEFRASLYKG
VNSDVEVCVGNGNFTYQPQFRSNAEFNCDGDFDNETVTFRLWNLHVNHTDIYFCKIEFMY
PPPYLDNEKSNGTIIHIKEKHLCHAQTSPKLFWALVVVAGVLFCYGLLVTVALCVIWTNS
RRNRLLQSDYMNMTPRVLGPSRKPYQPYAPARDFAAYRP
NT seq 660 nt   +upstreamnt  +downstreamnt
atgacactcaggctgctgttcttggctctcaacttcttctcctcagttcaagtaacagaa
aacaagattttggtgaagcagtcccccctgcttgtggtagatagcaacgaggtcagcctc
agctgcaggtattcgtacaaccttcttgcaaaggagttccgtgcatccctttacaagggt
gtgaacagcgacgtggaagtctgtgttgggaatgggaattttacctatcagccccagttt
cgctcaaatgcggagttcaactgtgacggggatttcgacaatgaaacagtgacgttccgt
ctctggaatctgcatgttaatcacacagatatttacttctgcaaaattgagttcatgtat
cctccgccttacctagacaacgagaagagcaatggaactattattcacataaaagagaaa
catctttgtcatgctcagacatctcctaagctgttttgggcactggtcgtggttgctgga
gtcctgttttgttatggcttgctagtgacagtggctctttgtgttatctggacaaatagc
agaaggaacagactccttcaaagtgactacatgaacatgactccccgggtgcttggaccc
tctcgcaagccttaccagccctacgcccctgccagagactttgcagcataccgcccctga

DBGET integrated database retrieval system