Mus pahari (shrew mouse): 110322547 Help Entry 110322547         CDS       T05929                                  Symbol Il10 Name (RefSeq) interleukin-10   KO K05443   interleukin 10 Organism mpah  Mus pahari (shrew mouse) Pathway mpah04060   Cytokine-cytokine receptor interaction mpah04061   Viral protein interaction with cytokine and cytokine receptor mpah04068   FoxO signaling pathway mpah04148   Efferocytosis mpah04625   C-type lectin receptor signaling pathway mpah04630   JAK-STAT signaling pathway mpah04660   T cell receptor signaling pathway mpah04672   Intestinal immune network for IgA production mpah05133   Pertussis mpah05135   Yersinia infection mpah05140   Leishmaniasis mpah05142   Chagas disease mpah05143   African trypanosomiasis mpah05144   Malaria mpah05145   Toxoplasmosis mpah05146   Amoebiasis mpah05150   Staphylococcus aureus infection mpah05152   Tuberculosis mpah05310   Asthma mpah05320   Autoimmune thyroid disease mpah05321   Inflammatory bowel disease mpah05322   Systemic lupus erythematosus mpah05330   Allograft rejection Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     110322547 (Il10)    04068 FoxO signaling pathway     110322547 (Il10)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     110322547 (Il10)    04061 Viral protein interaction with cytokine and cytokine receptor     110322547 (Il10)  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     110322547 (Il10)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     110322547 (Il10)    04660 T cell receptor signaling pathway     110322547 (Il10)    04672 Intestinal immune network for IgA production     110322547 (Il10)  09160 Human Diseases   09171 Infectious disease: bacterial    05135 Yersinia infection     110322547 (Il10)    05133 Pertussis     110322547 (Il10)    05150 Staphylococcus aureus infection     110322547 (Il10)    05152 Tuberculosis     110322547 (Il10)   09174 Infectious disease: parasitic    05146 Amoebiasis     110322547 (Il10)    05144 Malaria     110322547 (Il10)    05145 Toxoplasmosis     110322547 (Il10)    05140 Leishmaniasis     110322547 (Il10)    05142 Chagas disease     110322547 (Il10)    05143 African trypanosomiasis     110322547 (Il10)   09163 Immune disease    05310 Asthma     110322547 (Il10)    05322 Systemic lupus erythematosus     110322547 (Il10)    05320 Autoimmune thyroid disease     110322547 (Il10)    05321 Inflammatory bowel disease     110322547 (Il10)    05330 Allograft rejection     110322547 (Il10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mpah04052]     110322547 (Il10)    00536 Glycosaminoglycan binding proteins [BR:mpah00536]     110322547 (Il10) Cytokines and neuropeptides [BR:mpah04052]  Cytokines   Interleukins    110322547 (Il10) Glycosaminoglycan binding proteins [BR:mpah00536]  Heparan sulfate / Heparin   Cytokines    110322547 (Il10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL10 IL22 RIN1 Motif Other DBs NCBI-GeneID:  110322547 NCBI-ProteinID:  XP_021054894 Ensembl:  MGP_PahariEiJ_G0027799 LinkDB All DBs Position 5:105295050..105299590 Genome browser AA seq 178 aa AA seqDB search MPGSALLCCLLLLAGVRISRGQYTREDNNCTHFPVSQTHMLRELRTAFSQVKTFFQTKDQ LDNILLNDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLR MRLRRCHRFLPCENKSKAVEQVKNDFNKLQDKGVYKAMNEFDIFINCIEAYMKIKMKS NT seq 537 nt NT seq  +upstreamnt  +downstreamnt atgcctggctcagcactgctatgctgcctgctcttactggctggtgtgaggatcagcaga ggccagtacacccgggaagacaacaactgcacccatttcccagtcagccagacccacatg ctccgagagctgcggacggccttcagccaggtgaagactttctttcaaacaaaggaccag ctggacaacatactgctaaacgattccttaatgcaggactttaagggttacttgggttgc caagccttatcagaaatgatccagttttacctggtagaagtgatgccccaagcagagaag catggcccggaaatcaaggagcatttgaattccctgggagagaagctgaagaccctcagg atgcggctgcggcgctgtcatcgatttctcccctgtgaaaataagagcaaggcggtggag caggtgaagaatgattttaataagctccaagacaaaggcgtctacaaggccatgaatgaa tttgacatcttcatcaactgcatagaagcatacatgaagatcaaaatgaaaagctaa

DBGET integrated database retrieval system