KEGG   Mus pahari (shrew mouse): 110322547
Entry
110322547         CDS       T05929                                 
Symbol
Il10
Name
(RefSeq) interleukin-10
  KO
K05443  interleukin 10
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04061  Viral protein interaction with cytokine and cytokine receptor
mpah04068  FoxO signaling pathway
mpah04625  C-type lectin receptor signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04660  T cell receptor signaling pathway
mpah04672  Intestinal immune network for IgA production
mpah05133  Pertussis
mpah05135  Yersinia infection
mpah05140  Leishmaniasis
mpah05142  Chagas disease
mpah05143  African trypanosomiasis
mpah05144  Malaria
mpah05145  Toxoplasmosis
mpah05146  Amoebiasis
mpah05150  Staphylococcus aureus infection
mpah05152  Tuberculosis
mpah05310  Asthma
mpah05320  Autoimmune thyroid disease
mpah05321  Inflammatory bowel disease
mpah05322  Systemic lupus erythematosus
mpah05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110322547 (Il10)
   04068 FoxO signaling pathway
    110322547 (Il10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110322547 (Il10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    110322547 (Il10)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110322547 (Il10)
   04660 T cell receptor signaling pathway
    110322547 (Il10)
   04672 Intestinal immune network for IgA production
    110322547 (Il10)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110322547 (Il10)
   05133 Pertussis
    110322547 (Il10)
   05150 Staphylococcus aureus infection
    110322547 (Il10)
   05152 Tuberculosis
    110322547 (Il10)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110322547 (Il10)
   05144 Malaria
    110322547 (Il10)
   05145 Toxoplasmosis
    110322547 (Il10)
   05140 Leishmaniasis
    110322547 (Il10)
   05142 Chagas disease
    110322547 (Il10)
   05143 African trypanosomiasis
    110322547 (Il10)
  09163 Immune disease
   05310 Asthma
    110322547 (Il10)
   05322 Systemic lupus erythematosus
    110322547 (Il10)
   05320 Autoimmune thyroid disease
    110322547 (Il10)
   05321 Inflammatory bowel disease
    110322547 (Il10)
   05330 Allograft rejection
    110322547 (Il10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110322547 (Il10)
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110322547 (Il10)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Interleukins
   110322547 (Il10)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Cytokines
   110322547 (Il10)
SSDB
Motif
Pfam: IL10 IL22
Other DBs
NCBI-GeneID: 110322547
NCBI-ProteinID: XP_021054894
Ensembl: MGP_PahariEiJ_G0027799
LinkDB
Position
5:105295050..105299590
AA seq 178 aa
MPGSALLCCLLLLAGVRISRGQYTREDNNCTHFPVSQTHMLRELRTAFSQVKTFFQTKDQ
LDNILLNDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLR
MRLRRCHRFLPCENKSKAVEQVKNDFNKLQDKGVYKAMNEFDIFINCIEAYMKIKMKS
NT seq 537 nt   +upstreamnt  +downstreamnt
atgcctggctcagcactgctatgctgcctgctcttactggctggtgtgaggatcagcaga
ggccagtacacccgggaagacaacaactgcacccatttcccagtcagccagacccacatg
ctccgagagctgcggacggccttcagccaggtgaagactttctttcaaacaaaggaccag
ctggacaacatactgctaaacgattccttaatgcaggactttaagggttacttgggttgc
caagccttatcagaaatgatccagttttacctggtagaagtgatgccccaagcagagaag
catggcccggaaatcaaggagcatttgaattccctgggagagaagctgaagaccctcagg
atgcggctgcggcgctgtcatcgatttctcccctgtgaaaataagagcaaggcggtggag
caggtgaagaatgattttaataagctccaagacaaaggcgtctacaaggccatgaatgaa
tttgacatcttcatcaactgcatagaagcatacatgaagatcaaaatgaaaagctaa

DBGET integrated database retrieval system