KEGG   Mus pahari (shrew mouse): 110322814
Entry
110322814         CDS       T05929                                 
Symbol
Ptprf
Name
(RefSeq) receptor-type tyrosine-protein phosphatase F isoform X1
  KO
K05695  receptor-type tyrosine-protein phosphatase F [EC:3.1.3.48]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04520  Adherens junction
mpah04910  Insulin signaling pathway
mpah04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110322814 (Ptprf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110322814 (Ptprf)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    110322814 (Ptprf)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    110322814 (Ptprf)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mpah01009]
    110322814 (Ptprf)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     110322814 (Ptprf)
Protein phosphatases and associated proteins [BR:mpah01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    110322814 (Ptprf)
SSDB
Motif
Pfam: Y_phosphatase fn3 I-set Ig_3 Pur_ac_phosph_N Ig_2 ig fn3_2 Interfer-bind V-set DSPc C2-set_2 Y_phosphatase3 PTPlike_phytase Insulin_TMD DUF3377 ICAM_N
Other DBs
NCBI-GeneID: 110322814
NCBI-ProteinID: XP_021055262
Ensembl: MGP_PahariEiJ_G0028702
LinkDB
Position
6:complement(69358794..69441176)
AA seq 1920 aa
MAPEPAPGRRMVPLVPALVMLGLMAGAHGDSKPVFVKVPEDQTGLSGGVASFVCQATGEP
KPRITWMKKGKKVSSQRFEVIEFDDGAGSVLRIQPLRVQRDEAIYECTATNSLGEINTSA
KLSVLEEDQLPSGFPTIDMGPQLKVVEKGRTATMLCAAGGNPDPEISWFKDFLPVDPAAS
NGRIKQLRSGELSGSPIRGALQIESSEESDQGKYECVATNSAGTRYSAPANLYVRDQREV
RRVAPRFSIPPSSQEVMPGGSVNLTCVAVGAPMPYVKWMMGAEELTKEDEMPVGRNVLEL
SNVMRSANYTCVAISSLGMIEATAQVTVKALPKPPIDLVVTETTATSVTLTWDSGNTEPV
SFYGIQYRAAGTDGPFQEVDGVASTRYSIGGLSPFSEYAFRVLAVNSIGRGPPSEAVRAR
TGEQAPSSPPRRVQARMLSASTMLVQWEPPEEPNGLVRGYRVYYTPDSRRPLSAWHKHNT
DAGLLTTVGSLLPGITYSLRVLAFTAVGDGPPSPTIQVKTQQGVPAQPADFQANAESDTR
IQLSWLLPPQERIVKYELVYWAAEDEGQQHKVTFDPTSSYTLEDLKPDTLYHFQLAARSD
LGVGVFTPTVEARTAQSTPSAPPQKVTCVSTGSTTVRVSWVPPPADSRNGIITQYSVAYE
AVDGEDRKRHVVDGISREHSSWDLLGLEKWTEYRVWVRAHTDVGPGPESSPVLVRTDEDV
PSGPPRKVEVEPLNSTAVHVSWKLPVPNKQHGQIRGYQVTYVRLENGEPRGQPIIQDVML
AEAQWRPEESEDYETTISGLTPETTYSITVAAYTTKGDGARSKPKVVTTTGAVPGRPTMM
VSTTAMHTALLQWHPPKELPGELLGYRLQYRRADEARPNTIDFGKDDQHFTVTGLHKGAT
YVFRLAAKNRAGPGEEFEKEITTPEDVPSGFPQNLRVTGLTTXTTELTWDPPVLAERNGR
ITNYTVVYRDINSQLELQNVTDDIHLTLLGLKPDTTYDIKVRAHTSKGAGPLSPSIQSRT
MPMEQVFAKNFRVAAAMKTSVLLSWEVPDSYKSAVPFKILYNGQSVEVDGHSMRKLIADL
QPNTEYSFVLMNRGSSAGGLQHLVSIRTAPDLLPQKPMPASAFIEDGRFSLSMPQVQDPS
LVRWFYIVVVPIDRVGGNLLAPRWNTPEELELDELLEAIEQGEERERRRRRQAERLKPYV
AAQVDELPETFTLGDKKNYRGFYNRPLSPDLSYQCFVLASLKEPMDQKRYASSPYSDEIV
VQVTPAQQQEEPEMLWVTGPVLAVILIILIVIAILLFKRKRTHSPSSKDEQSIGLKDSLL
AHSSDPVEMRRLNYQTPGMRDHPPIPITDLADNIERLKANDGLKFSQEYESIDPGQQFTW
ENSNSEVNKPKNRYANVIAYDHSRVLLTSIDGVPGSDYINANYIDGYRKQNAYIATQGPL
PETMGDFWRMVWEQRTATVVMMTRLEEKSRVKCDQYWPARGTETYGLIQVTLVDTVELAT
YTMRTFALHKSGSSEKRELRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPLDAGPMVVH
CSAGVGRTGCFIVIDAMLERMKHEKTVDIYGHVTCMRSQRNYMVQTEDQYVFIHEALLEA
AMCGHTEVLARNLYAHIQKLGQVPPGESVTAMELEFKLLANSKAHTSRFVSANLPCNKFK
NRLVNIMPYELTRVCLQPIRGVEGSDYINASFLDGYRQQKAYIATQGPLTESTEDFWRML
WEHNSTIIVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDA
RDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTG
VFVTLSIVLERMRYEGVVDMFQTVKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFDHYAT
NT seq 5763 nt   +upstreamnt  +downstreamnt
atggcccccgagccagccccagggaggaggatggtgccccttgtgcctgccctcgtgatg
cttggcttgatggcaggtgctcatggcgacagcaaacctgtctttgttaaggtcccggag
gaccagactgggctgtcgggaggggtggcctccttcgtgtgccaagccacaggggaaccc
aagcctcgaatcacgtggatgaagaaggggaagaaagtcagctcccagcgctttgaggta
attgagtttgacgatggagcagggtcagtgctacggatccagccattacgagtgcagcga
gacgaagccatctatgagtgcacagccacgaacagtctcggggagatcaacacaagtgcc
aagctgtcagtgcttgaagaggaccagctgccgtctgggttcccaaccatcgacatggga
cctcagctgaaggtggtggagaagggtcgcactgccaccatgctgtgcgcagccggtggg
aacccggaccctgagatctcttggttcaaagacttccttcctgtggaccctgctgcaagc
aacggtcgtatcaagcagctgcgttcaggtgagctgagtggttcaccaatcagaggtgca
ttgcagatagagagcagcgaggagtctgaccaaggcaagtacgagtgtgtggccaccaac
tctgcaggcacacgctactcggcccccgccaacctgtatgtgcgagatcagcgagaagtg
cgtcgcgtggctcctcgtttctccatccctcccagcagccaagaggtgatgccaggcggc
agtgtgaatctcacgtgtgtggcagtgggcgcgcccatgccgtatgtgaagtggatgatg
ggcgccgaggagctgaccaaagaggatgagatgccagtcggccgcaacgttctggagctc
agcaatgtcatgcggtctgccaactatacctgtgtggccatctcttcactaggcatgata
gaggccacggcccaggtcacagtaaaagctctgccaaagcctccaattgatcttgtggtg
acagagacaaccgccaccagtgttactctgacatgggactctgggaataccgagcctgtg
tccttctatggcatccagtaccgtgcagctggcacagacggccccttccaggaagtggat
ggtgtggccagcacccgatacagcattggtggcctcagccccttttcggaatatgctttc
cgtgtgttggctgttaacagcattgggcgaggaccacccagtgaggcggtgagagcacgc
acgggggagcaggcgccctccagccctccgcgccgtgtgcaggcccgaatgcttagcgct
agcaccatgctggtccagtgggaaccacctgaagagcccaatggcctggtacggggatat
cgcgtctactacaccccagattcccgacgccctttgagcgcctggcacaagcataacacc
gacgcaggacttcttaccaccgtgggcagcctgctacctggcatcacctacagcctccga
gtccttgccttcactgccgtgggcgacggcccacccagccccaccatccaagtcaagaca
cagcagggagtgcctgcacagcctgcggacttccaggccaacgctgagtcggacaccagg
atccagctctcctggctgctgcccccgcaggagcggatcgtcaagtatgagctggtgtac
tgggcagccgaggacgagggccagcagcacaaggtgaccttcgaccccacctcctcctac
actctggaggacctgaagcctgacacactgtaccacttccagctggctgcacgttcagat
ttgggggtgggcgtcttcacgcccaccgtagaggcccgtacagcacagtccaccccatca
gcccctccccagaaggtgacatgtgtgagcacgggctccaccacggtccgggtaagttgg
gttccaccgccggctgacagccgcaacggcattatcacccagtactccgtggcctatgag
gcagtggacggcgaggaccgtaagcgacatgtggtggatggcatcagccgtgagcattcc
agctgggacctgctgggcctggagaagtggacggagtaccgggtgtgggtgcgggcacac
acagatgtgggccctggccctgagagcagcccggtgctggtgcgcaccgacgaggacgtg
cctagcgggccaccacggaaggtggaggttgagcctctgaactccactgctgtgcatgtc
tcctggaagctgcctgtccccaacaagcagcacggacagattcgtggctaccaggtcacc
tatgtgcggctagagaatggtgagccccgaggccaacccatcatccaggatgtcatgctg
gctgaggctcagtggagaccagaggagtccgaggactatgaaaccaccatcagcggcctc
acccccgagaccacctactccatcaccgtcgctgcctacaccactaagggggatggtgcc
cgaagcaagcccaaggtggttactacgacaggggcagtcccaggacggcccaccatgatg
gtcagcaccacggccatgcacaccgcgctgctgcagtggcacccaccgaaggagctgcct
ggagagctgctgggctacaggctccaataccggcgggccgacgaggcgcggcccaatacc
atagactttggaaaggatgaccaacattttacagttaccggcctgcacaaaggggccacc
tacgtcttccggctcgctgccaagaaccgagctggcccaggagaagagtttgagaaagag
atcaccacccccgaggatgtgcccagtggctttcctcaaaaccttcgagtgacaggactg
accacatngaccacggaactgacctgggacccgccggtgctggcggagaggaatggtcgc
atcaccaactataccgtggtctaccgtgacatcaacagccagcttgagctccagaatgtc
actgacgacatacaccttacactcttgggcctcaaaccagacaccacttacgacatcaag
gtccgtgcacataccagcaaaggcgccggcccactcagccccagcatccagtcccggacc
atgcctatggagcaagtgtttgccaaaaatttccgtgtggccgctgcaatgaagacatct
gtgctgctcagttgggaggtccccgactcttacaagtcagccgtgcccttcaagatcctg
tacaatggacagagcgtggaggtggacgggcactcgatgcggaagctgattgcagacctg
caacccaacacggagtactccttcgtcctgatgaatcgtggcagtagcgccgggggccta
cagcacctggtgtccatccgcactgccccggacctcctgccccagaagccaatgcctgcc
tccgcctttatagaggatggccgcttctccctctccatgcctcaagtgcaggacccctcg
ctagtcaggtggttctacattgtggtggtgcccattgaccgtgtgggcgggaacttgctg
gcaccaagatggaacacaccagaggagttggagctggacgagcttctggaggccatcgag
cagggcgaggagagagagcggaggcgccggcgccaagcagagcggctgaagccttatgtg
gcagcccaagtggatgagcttcctgagaccttcaccctaggggacaaaaagaactaccgt
ggcttctacaaccgacccctttctccggatctgagttaccagtgctttgtcctcgcctcc
ctcaaggaacccatggaccagaagcgctacgcctccagcccctactcggacgagattgta
gtccaggtgacgccggcacagcagcaggaggaacccgagatgctgtgggtgacaggcccc
gtcctggcggtcattctcatcatactcatcgtcatcgccatcctcctgttcaagaggaag
agaacacattcaccgtcatcaaaggacgagcagtctatcgggctaaaggactccctgttg
gcccactcttctgaccctgtggagatgcgaaggcttaactaccagaccccaggtatgcga
gaccacccgcccatccccatcactgacctggcagacaatattgagcgcctcaaagccaac
gatgggcttaagttctcccaggagtatgagtccattgaccctggacagcagttcacatgg
gagaattccaactcagaggtgaacaagcccaagaaccgctatgcaaacgtcattgcctat
gaccattctcgagtcctcctcacctccattgatggtgttcctgggagtgactatatcaat
gccaactacattgatggctaccgaaagcagaatgcctacattgccacacagggtccgctg
cctgagaccatgggcgatttctggaggatggtgtgggaacagcgtacagccacagtggtc
atgatgaccagactagaggagaaatcccgggtgaagtgtgatcagtattggccagcccgt
ggcactgagacctatggcctcattcaggtgaccctggtggacactgtggaattggccaca
tacaccatgcgcacctttgccctccataagagtggctccagtgagaagcgtgagctgcgt
cagttccagttcatggcctggccagaccatggcgttcctgagtaccccactcccatcttg
gccttcctgagacgggtcaaggcctgtaacccactagatgcggggcccatggtggtgcat
tgcagtgccggtgtgggccgcacgggctgcttcatcgtcatcgacgcaatgctggagcgt
atgaagcacgagaagacggtcgacatctatggccacgtgacgtgcatgcgctcacaaagg
aactacatggtgcagaccgaggaccagtatgtgttcatccatgaggcactgttagaggct
gccatgtgcggacacaccgaggtgcttgctcggaacctctatgcccacatccagaaacta
ggccaagtgcctcctggggagagcgtcacagccatggaacttgagttcaagttgctggcc
aactccaaggcccacacgtcgcgcttcgttagtgccaacctgccctgcaacaagttcaag
aaccgcctggtgaacatcatgccctatgagctgacccgagtgtgcttgcaacccatccgt
ggcgtggagggctcggactacatcaatgccagctttctagatggttacagacagcagaag
gcctacatagctacacaggggcctctgacagagagcaccgaggacttctggcgcatgtta
tgggagcacaattccaccatcatcgtcatgctgaccaagcttcgggagatgggcagggag
aaatgtcaccagtactggccagcagagcgctccgctcgctatcaatacttcgtggttgat
ccgatggctgagtacaacatgccccagtatatcctgcgtgaattcaaagtcacagatgcc
cgggacgggcagtcaaggacaatccgacagttccagtttacagactggccagagcaagga
gtacccaaaaccggtgaaggcttcatcgacttcatcgggcaggtgcacaagacaaaggag
cagtttggccaggacgggcccatcacggtgcactgcagtgctggtgtgggccgcaccggt
gtgttcgtcaccctgagcattgtcctggagcgcatgcggtacgagggcgtggttgacatg
ttccagaccgtgaaaaccctccgcacacagcgccctgcaatggtgcagacagaggaccaa
taccagctgtgctaccgtgcggccctggaatacctcggcagctttgatcactatgcaacg
taa

DBGET integrated database retrieval system