Mus pahari (shrew mouse): 110323346 Help Entry 110323346         CDS       T05929                                  Symbol Ifnb1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism mpah  Mus pahari (shrew mouse) Pathway mpah04060   Cytokine-cytokine receptor interaction mpah04151   PI3K-Akt signaling pathway mpah04217   Necroptosis mpah04380   Osteoclast differentiation mpah04620   Toll-like receptor signaling pathway mpah04621   NOD-like receptor signaling pathway mpah04622   RIG-I-like receptor signaling pathway mpah04623   Cytosolic DNA-sensing pathway mpah04630   JAK-STAT signaling pathway mpah04650   Natural killer cell mediated cytotoxicity mpah04668   TNF signaling pathway mpah04936   Alcoholic liver disease mpah05135   Yersinia infection mpah05142   Chagas disease mpah05152   Tuberculosis mpah05160   Hepatitis C mpah05161   Hepatitis B mpah05162   Measles mpah05163   Human cytomegalovirus infection mpah05164   Influenza A mpah05165   Human papillomavirus infection mpah05167   Kaposi sarcoma-associated herpesvirus infection mpah05168   Herpes simplex virus 1 infection mpah05169   Epstein-Barr virus infection mpah05170   Human immunodeficiency virus 1 infection mpah05171   Coronavirus disease - COVID-19 mpah05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     110323346 (Ifnb1)    04668 TNF signaling pathway     110323346 (Ifnb1)    04151 PI3K-Akt signaling pathway     110323346 (Ifnb1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     110323346 (Ifnb1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     110323346 (Ifnb1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     110323346 (Ifnb1)    04621 NOD-like receptor signaling pathway     110323346 (Ifnb1)    04622 RIG-I-like receptor signaling pathway     110323346 (Ifnb1)    04623 Cytosolic DNA-sensing pathway     110323346 (Ifnb1)    04650 Natural killer cell mediated cytotoxicity     110323346 (Ifnb1)   09158 Development and regeneration    04380 Osteoclast differentiation     110323346 (Ifnb1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     110323346 (Ifnb1)    05161 Hepatitis B     110323346 (Ifnb1)    05160 Hepatitis C     110323346 (Ifnb1)    05171 Coronavirus disease - COVID-19     110323346 (Ifnb1)    05164 Influenza A     110323346 (Ifnb1)    05162 Measles     110323346 (Ifnb1)    05168 Herpes simplex virus 1 infection     110323346 (Ifnb1)    05163 Human cytomegalovirus infection     110323346 (Ifnb1)    05167 Kaposi sarcoma-associated herpesvirus infection     110323346 (Ifnb1)    05169 Epstein-Barr virus infection     110323346 (Ifnb1)    05165 Human papillomavirus infection     110323346 (Ifnb1)   09171 Infectious disease: bacterial    05135 Yersinia infection     110323346 (Ifnb1)    05152 Tuberculosis     110323346 (Ifnb1)   09174 Infectious disease: parasitic    05142 Chagas disease     110323346 (Ifnb1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     110323346 (Ifnb1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     110323346 (Ifnb1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mpah04052]     110323346 (Ifnb1) Cytokines and neuropeptides [BR:mpah04052]  Cytokines   Interferons    110323346 (Ifnb1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon YWFCY Tat Spore_III_AB Motif Other DBs NCBI-GeneID:  110323346 NCBI-ProteinID:  XP_021056175 Ensembl:  MGP_PahariEiJ_G0028479 LinkDB All DBs Position 6:complement(40508909..40509665) Genome browser AA seq 182 aa AA seqDB search MNNRWILHAAFLLCFSTTALSINYEQLQLQQRTRIRKCQKLLEQLNGKINLSYRTDFKIP MEMMEKMQKSYTAFAIQEMLQNVFLVFKNNFSSTGWNETIVERLLDELHGQTEFLKTILK EKQEERLMWPVSSTALHLKSYYWRVQRYLKLNKYNSYAWMVVRAEIFRNFSIIRRLARNF QN NT seq 549 nt NT seq  +upstreamnt  +downstreamnt atgaacaataggtggatcctccacgctgcgttcctgctgtgcttctccaccacggccctc tccatcaactacgagcagctccagctccaacaaaggacgaggattcggaaatgtcagaag ctcctggagcagctgaatggaaagatcaacctcagctacaggacggacttcaagattcct atggagatgatggagaagatgcagaagagttacactgcctttgccatccaagagatgctc cagaatgtctttcttgtcttcaaaaacaatttctccagcaccgggtggaatgagactatt gttgaacgcctcctggatgaactccatgggcagacagagtttctgaagacaatactaaag gaaaagcaggaggaaagattgatgtggccggtatcctcaactgctctccacttgaagagc tattactggagggtgcaaaggtaccttaaactcaataagtacaacagctatgcctggatg gtggtccgagcagagatcttcaggaacttttccatcattcgaagacttgctagaaacttc cagaactga

DBGET integrated database retrieval system