KEGG   Mus pahari (shrew mouse): 110324181
Entry
110324181         CDS       T05929                                 

Gene name
Rock2
Definition
(RefSeq) rho-associated protein kinase 2
  KO
K17388  Rho-associated protein kinase 2 [EC:2.7.11.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04022  cGMP-PKG signaling pathway
mpah04024  cAMP signaling pathway
mpah04062  Chemokine signaling pathway
mpah04071  Sphingolipid signaling pathway
mpah04270  Vascular smooth muscle contraction
mpah04310  Wnt signaling pathway
mpah04360  Axon guidance
mpah04510  Focal adhesion
mpah04530  Tight junction
mpah04611  Platelet activation
mpah04670  Leukocyte transendothelial migration
mpah04810  Regulation of actin cytoskeleton
mpah04921  Oxytocin signaling pathway
mpah05132  Salmonella infection
mpah05135  Yersinia infection
mpah05163  Human cytomegalovirus infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110324181 (Rock2)
   04071 Sphingolipid signaling pathway
    110324181 (Rock2)
   04024 cAMP signaling pathway
    110324181 (Rock2)
   04022 cGMP-PKG signaling pathway
    110324181 (Rock2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110324181 (Rock2)
   04530 Tight junction
    110324181 (Rock2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110324181 (Rock2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110324181 (Rock2)
   04670 Leukocyte transendothelial migration
    110324181 (Rock2)
   04062 Chemokine signaling pathway
    110324181 (Rock2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    110324181 (Rock2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    110324181 (Rock2)
  09158 Development and regeneration
   04360 Axon guidance
    110324181 (Rock2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110324181 (Rock2)
   05205 Proteoglycans in cancer
    110324181 (Rock2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    110324181 (Rock2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110324181 (Rock2)
   05135 Yersinia infection
    110324181 (Rock2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110324181 (Rock2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110324181 (Rock2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mpah03036]
    110324181 (Rock2)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110324181 (Rock2)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   110324181 (Rock2)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    110324181 (Rock2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Rho_Binding PH C1_1 APH Pkinase_C
Other DBs
NCBI-GeneID: 110324181
NCBI-ProteinID: XP_021057163
Ensembl: MGP_PahariEiJ_G0029387
LinkDB
Position
7
AA seq 1388 aa
MSRPPPTGKMPGAPEAAPGDGAGAGRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFP
ALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAM
KLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFCAFQDDRYLYMVMEYMPGGDLVNL
MSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMD
EIGMVHCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLFEMLVGDTPFYADSLV
GTYSKIMDHKNSLCFPEDTEISKHAKNLICAFLTDREVRLGRNGVEEIKQHPFFKNDQWN
WDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYFRENL
LLSDSPPCRENDAIQTRKSEESQEIQKKLYALEEHLSSEVQAKEELEQKCKSINTRLEKT
AKELEEEITLRKNVESTLRQLEREKALLQHKNAEYQRKADHEADKKRNLENDVNSLKDQL
EDLKKRNQSSQISTERVNQLQKQLDEANALLRTESDTAARLRKTQAESSKQIQQLESNNR
DLQDKNCLLETAKLKLEKEFINLQSALESERRDRTHGSEIINDLQGRISGLEEDLKTGKA
LLTKVELEKRQLQEKLTDLEKEKSNMEIDMTYQLKVIQQSLEQEEAEHKTTKARLADKNK
IYESIEEAKSEAMKEMEKKLLEERSLKQKVENLLLEAEKRCSILDCDLKQSQQKLNELLK
QKDVLNEDVRNLTLKIEQETQKRCLMQNDLKMQTQQVNTLKMSEKQIKQENNHLMEMKMN
LEKQNAELRKERQDADGQMKELQDQLEAEQYFSTLYKTQVRELKEENEEKTKLCKELQQK
KQDLQDERDSLAAQLEITLTKADSEQLARSIAEEQYSDLEKEKIMKELEIKEMMARHKQE
LTEKDATIASLEETNRTLTSDVANLANEKEELNNKLKDSQEQLSKLKDEEISAAAIKAQF
EKQLLNERTLKTQAVNKLAEIMNRKEPVKRGSDTDVRRKEKENRKLHMELKSEREKLTQQ
MIKYQKELNEMQAQIAEESQIRIELQMTLDSKDSDIEQLRSQLQALHIGMDSSSIGSGPG
DAEPDDGFPESRLEGWLSLPVRNNTKKFGWVKKYVIVSSKKILFYDSEQDKEQSNPYMVL
DIDKLFHVRPVTQTDVYRADAKEIPRIFQILYANEGESKKEPEFPVEPVGEKSNYICHKG
HEFIPTLYHFPTNCEACMKPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYD
ISSAKNLLLLANSTEEQQKWVSRLVKKIPKKPPAPDPFARSSPRTSMKIQQNQSIRRPSR
QLAPNKPS
NT seq 4167 nt   +upstreamnt  +downstreamnt
atgagccggcccccgccgacggggaaaatgcccggcgcccccgaggccgctccgggggac
ggggcgggcgcgggccgtcagaggaagctggaggcgctcatccgagaccctcgctcgccc
atcaacgtggagagtctgctggatggcttaaattccttggtccttgatttggattttcct
gctttgaggaaaaataaaaatatagataatttcttaaatagatatgagaaaattgtgaaa
aaaatcagaggtttacagatgaaagcagaagactatgatgttgtaaaggttattggaaga
ggtgcttttggtgaagttcagttggttcgtcataaggcatcacagaaggtttatgcaatg
aagcttcttagtaaatttgaaatgataaaaagatcagattctgcttttttctgggaagaa
agagatattatggcctttgccaacagtccctgggtagttcagctcttctgtgcctttcaa
gatgacaggtacctgtacatggtgatggagtacatgccaggcggagacctcgtcaacctt
atgagtaattatgatgtgcctgaaaagtgggccaagttttacactgctgaagtagtgctt
gcactggatgcgatacactccatgggcttaatacacagagatgtgaaacctgataacatg
ctattggataaacatggacatctaaagttagcagattttggcacatgtatgaaaatggat
gaaataggcatggtgcattgcgatacagcagttggaactcctgattacatatcacctgag
gttctgaagtcacaaggaggtgatggttactatgggcgagaatgtgattggtggtctgta
ggtgttttcctttttgagatgttagtaggggacactccattttacgcagattcacttgta
ggaacctacagcaaaattatggatcataaaaattcactgtgttttcctgaagatacagag
atttctaaacatgcgaagaatctcatatgtgccttcttaacagacagggaggtacgactt
ggaagaaatggggtagaagaaatcaaacagcatcctttctttaagaatgatcaatggaat
tgggataacataagagagacggcagctccagtggtacctgagctcagcagtgacatagac
agcagcaactttgacgacattgaggatgacaaaggcgatgtagagaccttcccgattcct
aaagcttttgtgggaaatcagctgccttttataggatttacctactttagagaaaatttg
ttattaagtgactctccgccttgtagagaaaatgatgcaatacaaacaaggaaaagtgaa
gaaagtcaggagattcagaaaaaattatatgcactagaagaacaccttagcagtgaggtg
caagccaaggaggagctggaacagaagtgcaaatctattaatactcgcctagagaaaaca
gcgaaggagctagaagaagagattaccttacggaaaaatgtggaatcaacattaagacag
ctggaaagagaaaaggcccttcttcagcacaaaaatgcagaatatcaacggaaagccgat
catgaagctgacaagaaacggaacttggaaaatgatgttaacagcttaaaagatcaactt
gaagatctgaagaaaagaaaccagagctctcagatatccactgagagggtcaatcagctc
cagaaacaactggatgaagctaatgctttgctgagaacagagtctgatactgcagcccgg
ttaagaaaaacccaggcagaaagttccaaacagattcagcagctggaatctaacaataga
gatctacaagataaaaactgcctgcttgagactgccaagttaaaacttgaaaaggaattt
atcaatcttcagtcagctctagaatctgaaagaagggaccggacccatggatcagaaata
attaatgatttacaaggtagaatatctgggttggaagaagatttgaagactggcaaagcc
ttactaacaaaagtagagctggagaagagacagctgcaggagaagctcactgacttagag
aaggaaaaaagcaacatggaaatagatatgacatatcaactgaaagttatacagcagagt
ttagaacaagaagaagctgaacacaagaccacaaaagcacggctagcggataaaaataag
atctatgaatccattgaagaagctaaatcagaagccatgaaagaaatggagaagaagctg
ttggaagagaggtctttaaagcagaaagtggagaacctactcctggaagccgagaaaaga
tgttctatattggactgtgacctcaaacagtctcagcagaaactaaatgagctgctgaag
cagaaagatgtgctaaatgaggatgttagaaatttgacattaaaaatagagcaggaaact
cagaagcgttgtcttatgcaaaatgacctgaagatgcagacccaacaagttaacacccta
aaaatgtcagaaaagcaaataaaacaagaaaataatcatcttatggaaatgaaaatgaac
ttggaaaagcaaaatgctgaacttcgaaaagagcggcaggatgcagatgggcagatgaag
gaactgcaagaccaacttgaagcagagcagtatttctcaaccctctataaaacacaagtt
agagaacttaaagaagaaaatgaagagaagactaaactttgtaaagagttgcagcagaag
aagcaggatttacaggatgaaagagactctttggctgcccagctggagattacccttacc
aaagcagattctgagcagctggctcgttccattgctgaagaacaatattctgatttggaa
aaagagaagatcatgaaagagctggagatcaaagagatgatggctagacacaaacaagaa
cttactgaaaaggatgctacaattgcatctcttgaagaaacaaataggacattaactagt
gacgttgcaaatcttgcaaacgagaaagaagaattaaacaacaagctgaaagatagccaa
gaacaactgtcaaagttgaaagatgaagagatcagtgcagcagcgattaaagcacagttt
gagaagcagcttctgaatgagaggactctcaagactcaggctgtgaataagttggcggag
atcatgaatcgaaaagaacctgtcaagcgtggtagtgacacagatgtgcgaagaaaagag
aaggaaaacagaaagctacatatggagcttaagtctgaacgtgaaaaattgacacaacag
atgatcaaatatcagaaagaactgaatgaaatgcaggctcaaatagctgaagagagccaa
attcgaatagaactccagatgaccctggacagtaaagacagtgacattgaacagctgcgg
tcacagctccaggccttgcatattggtatggacagttccagtataggcagtggaccaggg
gatgctgagcctgatgatggatttccagaatcaagattggaaggatggttgtcattgcca
gtgcggaacaacactaaaaagtttggctgggttaaaaagtatgtgattgtaagcagcaag
aagattcttttctatgacagcgaacaagataaagagcagtccaacccttacatggtgtta
gacatagacaagctatttcacgtccgacctgttacccagacagatgtatacagagcagat
gctaaagaaattccaaggatatttcagattctatatgccaatgaaggagaaagtaagaaa
gaaccagagtttccagtggaaccagtgggagaaaaatctaattatatttgccacaaagga
catgagtttatccctactctttatcacttcccaaccaactgtgaggcatgtatgaagcca
ctgtggcacatgtttaaacctcctcctgctctagagtgccgtaggtgccacattaaatgt
cataaggatcacatggacaaaaaggaagagatcatagcaccctgcaaagtttattatgat
atatcatcggcaaagaatctgttgttattagcaaattcaacagaagaacagcagaaatgg
gttagtcggttggtgaaaaagatacctaaaaagcctccagctccagacccttttgcccga
tcatcccctagaacttcaatgaaaatacaacaaaaccagtccattcggcggcccagtcga
cagcttgctccaaacaagccaagctaa

KEGG   Mus pahari (shrew mouse): 110333549
Entry
110333549         CDS       T05929                                 

Gene name
Rock1
Definition
(RefSeq) rho-associated protein kinase 1
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04022  cGMP-PKG signaling pathway
mpah04024  cAMP signaling pathway
mpah04062  Chemokine signaling pathway
mpah04071  Sphingolipid signaling pathway
mpah04270  Vascular smooth muscle contraction
mpah04350  TGF-beta signaling pathway
mpah04360  Axon guidance
mpah04510  Focal adhesion
mpah04530  Tight junction
mpah04611  Platelet activation
mpah04670  Leukocyte transendothelial migration
mpah04810  Regulation of actin cytoskeleton
mpah04921  Oxytocin signaling pathway
mpah05135  Yersinia infection
mpah05163  Human cytomegalovirus infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    110333549 (Rock1)
   04071 Sphingolipid signaling pathway
    110333549 (Rock1)
   04024 cAMP signaling pathway
    110333549 (Rock1)
   04022 cGMP-PKG signaling pathway
    110333549 (Rock1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110333549 (Rock1)
   04530 Tight junction
    110333549 (Rock1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110333549 (Rock1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110333549 (Rock1)
   04670 Leukocyte transendothelial migration
    110333549 (Rock1)
   04062 Chemokine signaling pathway
    110333549 (Rock1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    110333549 (Rock1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    110333549 (Rock1)
  09158 Development and regeneration
   04360 Axon guidance
    110333549 (Rock1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110333549 (Rock1)
   05206 MicroRNAs in cancer
    110333549 (Rock1)
   05205 Proteoglycans in cancer
    110333549 (Rock1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    110333549 (Rock1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110333549 (Rock1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110333549 (Rock1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mpah03036]
    110333549 (Rock1)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110333549 (Rock1)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   110333549 (Rock1)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    110333549 (Rock1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Rho_Binding PH C1_1 HR1 Cortex-I_coil APH Pkinase_C
Other DBs
NCBI-GeneID: 110333549
NCBI-ProteinID: XP_021070782
Ensembl: MGP_PahariEiJ_G0018728
LinkDB
Position
15
AA seq 1354 aa
MSTGDSFETRFEKIDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYK
DTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFP
DDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLS
SDIDTSNFDDLEEDKGDEETFPIPKAFVGNQLPFVGFTYYSNRRYLPSANPSENRSSSNV
DKSLQESLQKTIYKLEEQLHNEMQLKDEMEQKCRTSNLKLDKIMKELDEEGNQRRNLESA
VSQIEKEKMLLQHRINEYQRKVEQENEKRRNIENEVSTLKDQLEDLRKASQSSQLANEKL
TQLQKQLEEANDLLRTESDTAVRLRKSHTEMSKSISQLESLNRELQERNRILENSKSQAD
KDYYQLQAVLEAERRDRGHDSEMIGDLQARITSLQEEVKHLKHNLERVEGERKEAQDMLN
HSEKEKNNLEIDLNYKLKSIQQRLEQEVNEHKVTKARLTDKHQSIEEAKSVAMCEMEKKL
KEEREAREKAENRIVETEKQCSMLDVDLKQSQQKLEHLTENKERMEDEVKNLTLQLEQES
NKRLLLQNELKTQAFEADNLKGLEKQMKQEINTLLEAKRLLEFELAQLTKQYRGNEGQMR
ELQDQLEAEQYFSTLYKTQVKELKEEIEEKNRENLRKIQELQSEKETLSTQLDLAETKAE
SEQLARGILEEQYFELTQESKKAASRNRQEITDKDHTVSRLEETNSVLTKDIEILRKENE
ELNERMRTAEEEYKLKKEEEISNLKAAFEKNISTERTLKTQAVNKLAEIMNRKDFKIDRK
KANTQDLRKKEKENRKLQLELNQEREKFNQMVVKHQKELNDMQAQLVEECTHRNELQMQL
ASKESDIEQLRAKLLDLSDSTSVASFPSADETDGNLPESRIEGWLSVPNRGNIKRYGWKK
QYVVVSSKKILFYNDEQDKEQSSPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIFQILY
ANEGECRKDIEVEPVQQGEKTNFQNHKGHEFIPTLYHFPANCEACAKPLWHVFKPPPALE
CRRCHVKCHRDHLDKKEDLISPCKVSYDVTSARDMLLLACSQDEQKKWVTHLVKKIPKNP
PSGFVRASPRTLSTRSTANQSFRKVVKNTSGKTS
NT seq 4065 nt   +upstreamnt  +downstreamnt
atgtcgactggggacagttttgagactcggtttgaaaaaatcgacaacctgctgcgggat
cccaaatcggaagtgaattcagattgtttgctggatggattggatgccctggtttatgat
ttggattttcctgccttaagaaaaaacaaaaatattgacaactttctaagcagatataaa
gacacaataaataaaattagagatttacggatgaaagcagaagattatgaagtagtaaag
gtaatcggcagaggcgcctttggagaagttcagttggtgaggcataaatccactaggaag
gtttatgctatgaagctgctcagcaaatttgaaatgatcaagagatcggattctgctttt
ttctgggaagaaagggacatcatggcgtttgccaatagtccttgggttgttcagcttttt
tatgcattccaagatgaccggtatctctacatggtgatggagtacatgcctggcggagac
cttgtcaacctgatgagcaactatgacgtgcctgaaaaatgggcaagattctatactgca
gaagtagtccttgcattggatgcgatccattccatgggttttattcatagagatgtaaag
cctgataacatgctgctggataagtctggacatttgaagttagcagattttggtacttgt
atgaagatgaataaggaaggtatggtacgatgtgatacagcagttggaacacctgattat
atctcacctgaagtattaaaatcccaaggcggtgatggctattatggacgagagtgtgac
tggtggtcagttggggtatttttatatgaaatgcttgtaggtgatacacctttttatgca
gattctttggttgggacttacagtaaaattatgaaccataaaaattcacttactttccct
gatgataatgatatatcaaaagaggcaaaaaatctcatttgtgccttccttacagacaga
gaagtgagattgggcagaaatggtgtagaggaaatcaaacgtcatctcttcttcaaaaat
gatcagtgggcttgggaaacgctccgagacactgtagcaccagttgtgcctgatttaagt
agtgacattgatactagtaattttgatgacttagaagaagataaaggagatgaagaaaca
tttcctattcctaaagcttttgttggcaatcagctaccttttgtaggatttacgtactat
agcaatcgtagatacttaccttcagcaaatcccagtgagaacagatctagctccaatgtg
gataaaagcttgcaggaaagtttacagaaaacaatctacaagcttgaagagcaactgcat
aatgaaatgcaattaaaagatgaaatggagcagaaatgcagaacttcaaacttaaaacta
gacaagataatgaaagaattggatgaagaggggaatcaaagacgaaatctagagtctgca
gtgtctcaaattgagaaagaaaagatgttgctacaacatagaattaatgagtaccaaaga
aaagtggaacaggaaaatgagaagagaagaaatatagaaaatgaagtttctacattaaag
gaccagttggaagacttacggaaagcaagtcagagctcacagcttgctaatgagaagctg
acacagttacagaagcagttagaagaagcgaatgacttacttaggacagaatcagacaca
gctgtaagattaaggaagagtcacacagagatgagcaagtcaattagtcagctagagtcc
ctgaacagagaattacaggaaagaaacagaattttagagaattccaagtcacaagcagac
aaggattactaccaactgcaagctgtattggaagctgagcgaagagacagagggcatgat
tctgagatgattggagaccttcaagcacgaattacatctttacaagaagaggtgaagcat
ctcaaacataatcttgaaagagtggaaggagaaagaaaagaggctcaagacatgcttaat
cattcagaaaaggaaaagaataatttggagatagatttgaattacaagctcaagtctata
caacagaggttagaacaagaagtaaatgaacataaagtaaccaaagcacgcctaactgac
aagcaccaatctatcgaagaggcaaagtctgttgccatgtgtgaaatggagaaaaagctg
aaggaagagagagaagctcgagagaaggctgaaaatagaattgttgagactgagaaacaa
tgttctatgctagatgttgacctgaaacagtctcagcagaagctagaacatttgactgaa
aataaagaaaggatggaggatgaagttaagaatctcaccctgcagctggaacaggaatca
aataaacggctcttgttacagaatgaattgaagactcaagcatttgaagcagacaattta
aaaggtttagaaaaacagatgaaacaggaaataaatactttattggaagcaaagagatta
ttagaatttgagttagctcagcttacaaagcagtataggggaaatgaagggcaaatgcgg
gagttacaagatcaacttgaagctgagcagtatttctctacactttataaaacccaagta
aaggaacttaaagaagaaattgaagaaaaaaacagagaaaatttaaggaaaatacaggaa
ctgcaaagtgaaaaagaaactctctctactcagttggacttagcagaaacaaaagctgag
tctgagcagctggcacgaggaattctggaagaacagtattttgagttgactcaggaaagc
aagaaagctgcttcaagaaatagacaagagattacagataaagatcacactgttagtcgg
cttgaagagacaaacagtgtgctaaccaaagatattgaaatactaagaaaagaaaatgaa
gagctaaatgaaagaatgaggacagcagaagaagaatataaattgaagaaggaagaagaa
ataagtaatcttaaggctgcttttgaaaagaatatcagtactgaacggacccttaaaaca
caggctgttaacaagttggcagaaataatgaatcgcaaagattttaaaattgatagaaag
aaagctaatactcaagatttgagaaaaaaagaaaaggaaaatagaaagctacaactggaa
cttaaccaagaaagagaaaaatttaaccaaatggtggtgaaacaccagaaggagctgaat
gacatgcaagcgcaattggtagaagaatgtacacatagaaatgaacttcaaatgcagttg
gctagcaaagagagtgatattgagcagttgcgggcaaaacttttggacctttcggattca
actagtgttgctagttttcctagtgctgatgagactgatggaaaccttccagagtcaaga
attgaaggttggctttctgtaccaaatagaggaaatatcaaaagatatggctggaagaaa
cagtatgttgtggtaagcagcaaaaagatcttgttctataatgatgaacaagataaggag
caatccagtccatctatggtgttagacatagataaattgtttcatgtccgacctgtaacc
caaggagatgtgtacagagcggaaactgaagaaattcctaaaatattccagatactatat
gcaaatgaaggtgaatgtagaaaagatatagaagtggaaccggttcaacaaggagaaaaa
actaatttccagaatcacaaaggccatgaattcattcctaccctctaccactttcctgcc
aactgtgaggcctgtgccaaacctttgtggcatgtctttaagccaccacctgccctagag
tgtcgaagatgccatgttaagtgccacagggaccatctagacaagaaagaggacttgatt
tccccgtgcaaagtaagttacgatgtaacatcagcaagagatatgctgctgttagcatgt
tctcaggatgaacaaaaaaagtgggttactcatctagtaaagaagattcctaagaaccca
ccatctggctttgttcgtgcctctcctcgaacgctgtcaacaagatccactgcaaatcag
tctttccgcaaagtagtcaaaaatacatctggaaaaactagttaa

DBGET integrated database retrieval system