KEGG   Mus pahari (shrew mouse): 110324728
Entry
110324728         CDS       T05929                                 
Symbol
Pomc
Name
(RefSeq) pro-opiomelanocortin
  KO
K05228  proopiomelanocortin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04024  cAMP signaling pathway
mpah04080  Neuroactive ligand-receptor interaction
mpah04915  Estrogen signaling pathway
mpah04916  Melanogenesis
mpah04920  Adipocytokine signaling pathway
mpah04925  Aldosterone synthesis and secretion
mpah04927  Cortisol synthesis and secretion
mpah04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    110324728 (Pomc)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110324728 (Pomc)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110324728 (Pomc)
   04915 Estrogen signaling pathway
    110324728 (Pomc)
   04916 Melanogenesis
    110324728 (Pomc)
   04925 Aldosterone synthesis and secretion
    110324728 (Pomc)
   04927 Cortisol synthesis and secretion
    110324728 (Pomc)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110324728 (Pomc)
SSDB
Motif
Pfam: ACTH_domain NPP Op_neuropeptide
Other DBs
NCBI-GeneID: 110324728
NCBI-ProteinID: XP_021058055
Ensembl: MGP_PahariEiJ_G0029337
LinkDB
Position
7:3211214..3216955
AA seq 235 aa
MPRFCYSRSGALLLALLLQTSIDVWGWCLESSQCQDLTTESNLLACIRACKLDLSAETPV
FPGNGDEQPLTENPRKYVMGHFRWDRFGPRNSSSAGGAAQRRAEEEAVGGDGGPEPKPRE
GKRSYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEFKRELEGERPDGLEHVPES
DTEKDDGPYRVEHFRWGNPPKDKRYGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQ
NT seq 708 nt   +upstreamnt  +downstreamnt
atgccgagattctgctacagtcgctcaggggccctgctgctggccctcctgcttcagacc
tccatagatgtgtggggctggtgcctggagagcagccagtgccaggacctcaccacagag
agcaacctgctggcttgcatccgggcttgcaaactcgacctctcggcggagacgcccgtg
tttccaggcaacggagatgaacagcccctgactgaaaacccccggaagtacgtcatgggt
cacttccgctgggaccgcttcggcccgaggaacagcagcagtgctggcggcgcggcgcag
aggcgtgcggaggaagaggcggtggggggagatggcggtccggagccgaaaccacgcgag
ggcaagcgctcctactccatggagcacttccgctggggcaagccggtgggcaagaagcgg
cgcccggtgaaggtgtaccccaacgtggctgagaacgagtcggcggaggcctttcccctg
gagttcaagagggagctggaaggcgagcggcccgacggcctggagcacgtcccggagtcc
gacaccgagaaggacgacgggccctatcgggtggagcacttccgctggggcaacccgccc
aaggacaagcgttacggtggcttcatgacctccgagaagagccagacgcccctggtgacg
ctcttcaagaacgccatcatcaagaacgcgcacaagaagggccagtga

DBGET integrated database retrieval system