Mus pahari (shrew mouse): 110326932 Help Entry 110326932         CDS       T05929                                  Symbol Ifng Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism mpah  Mus pahari (shrew mouse) Pathway mpah03050   Proteasome mpah04060   Cytokine-cytokine receptor interaction mpah04066   HIF-1 signaling pathway mpah04217   Necroptosis mpah04350   TGF-beta signaling pathway mpah04380   Osteoclast differentiation mpah04612   Antigen processing and presentation mpah04630   JAK-STAT signaling pathway mpah04650   Natural killer cell mediated cytotoxicity mpah04657   IL-17 signaling pathway mpah04658   Th1 and Th2 cell differentiation mpah04659   Th17 cell differentiation mpah04660   T cell receptor signaling pathway mpah04940   Type I diabetes mellitus mpah05140   Leishmaniasis mpah05142   Chagas disease mpah05143   African trypanosomiasis mpah05144   Malaria mpah05145   Toxoplasmosis mpah05146   Amoebiasis mpah05152   Tuberculosis mpah05160   Hepatitis C mpah05164   Influenza A mpah05168   Herpes simplex virus 1 infection mpah05200   Pathways in cancer mpah05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mpah05321   Inflammatory bowel disease mpah05322   Systemic lupus erythematosus mpah05323   Rheumatoid arthritis mpah05330   Allograft rejection mpah05332   Graft-versus-host disease mpah05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mpah00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     110326932 (Ifng)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     110326932 (Ifng)    04630 JAK-STAT signaling pathway     110326932 (Ifng)    04066 HIF-1 signaling pathway     110326932 (Ifng)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     110326932 (Ifng)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     110326932 (Ifng)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     110326932 (Ifng)    04612 Antigen processing and presentation     110326932 (Ifng)    04660 T cell receptor signaling pathway     110326932 (Ifng)    04658 Th1 and Th2 cell differentiation     110326932 (Ifng)    04659 Th17 cell differentiation     110326932 (Ifng)    04657 IL-17 signaling pathway     110326932 (Ifng)   09158 Development and regeneration    04380 Osteoclast differentiation     110326932 (Ifng)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110326932 (Ifng)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     110326932 (Ifng)   09172 Infectious disease: viral    05160 Hepatitis C     110326932 (Ifng)    05164 Influenza A     110326932 (Ifng)    05168 Herpes simplex virus 1 infection     110326932 (Ifng)   09171 Infectious disease: bacterial    05152 Tuberculosis     110326932 (Ifng)   09174 Infectious disease: parasitic    05146 Amoebiasis     110326932 (Ifng)    05144 Malaria     110326932 (Ifng)    05145 Toxoplasmosis     110326932 (Ifng)    05140 Leishmaniasis     110326932 (Ifng)    05142 Chagas disease     110326932 (Ifng)    05143 African trypanosomiasis     110326932 (Ifng)   09163 Immune disease    05322 Systemic lupus erythematosus     110326932 (Ifng)    05323 Rheumatoid arthritis     110326932 (Ifng)    05321 Inflammatory bowel disease     110326932 (Ifng)    05330 Allograft rejection     110326932 (Ifng)    05332 Graft-versus-host disease     110326932 (Ifng)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     110326932 (Ifng)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     110326932 (Ifng)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:mpah03051]     110326932 (Ifng)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mpah04052]     110326932 (Ifng)    00536 Glycosaminoglycan binding proteins [BR:mpah00536]     110326932 (Ifng) Proteasome [BR:mpah03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     110326932 (Ifng) Cytokines and neuropeptides [BR:mpah04052]  Cytokines   Interferons    110326932 (Ifng) Glycosaminoglycan binding proteins [BR:mpah00536]  Heparan sulfate / Heparin   Cytokines    110326932 (Ifng) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IFN-gamma DUF7774 Motif Other DBs NCBI-GeneID:  110326932 NCBI-ProteinID:  XP_021061252 Ensembl:  MGP_PahariEiJ_G0031245 LinkDB All DBs Position 9:complement(58251949..58256849) Genome browser AA seq 155 aa AA seqDB search MNATRCILALQLFLMAVSGCYCHGTLIESLESLKNYFNSSSIDVEEKSLFLDIWRNWQKD GDTKILESQVISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFE VDNPQIQRKAVSELIRVIHQLSPESSLRKRKRSRC NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgaacgctacacgctgcatcttggctttgcagctcttcctcatggctgtttctggctgt tactgccacggcacactcattgaaagcctagaaagtctgaagaactattttaactcaagt agcatcgatgtggaagaaaagagcctcttcttggatatctggaggaactggcaaaaggat ggtgacacgaaaatacttgagagccaggttatctctttctacctcagactctttgaagtc ttgaaggacaaccaggccatcagcaacaacataagcgtcattgaatcacacctgattact aacttcttcagcaacagtaaggcgaaaaaggatgcgttcatgagtatcgccaagtttgag gtagacaacccacagatccagcgcaaagccgtcagcgagctcatcagagtgatccaccag ctgtcgccagaatccagcctcaggaagcggaaaaggagtcggtgctga

DBGET integrated database retrieval system