KEGG   Mus pahari (shrew mouse): 110326961
Entry
110326961         CDS       T05929                                 
Symbol
Madcam1
Name
(RefSeq) mucosal addressin cell adhesion molecule 1 isoform X1
  KO
K06779  mucosal vascular addressin cell adhesion molecule 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110326961 (Madcam1)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    110326961 (Madcam1)
SSDB
Motif
Pfam: Adhes-Ig_like ICAM_N
Other DBs
NCBI-GeneID: 110326961
NCBI-ProteinID: XP_021061284
Ensembl: MGP_PahariEiJ_G0030945
LinkDB
Position
9:44196374..44200291
AA seq 405 aa
MESILALLLALALVPYQLSRGQSFQVNPPEPEVAVAMGTSLQITCSMSCDEGVARVHWRG
LDTSLGSVQTLPGSSILSVRGMLSDTGTPVCVGSCGSRSFQHSVKILVYAFPDQLVVSPE
FLVPGQDQVVSCTAHNIWPAGPNSLSFALLLGEQRLEGAQALEPEQEEEMQEAEGTPLFR
MTQRWLLPSLGTPAPPALHCQVTMQLPKLVLTHRREIPVLQSQTSPKPHNTTSAEPYILT
SSSTAEAVSTALHTTALPSAPPYSKLSPRTLSSEGPCHPKIHQDLEAGWELLCETSCGPG
FTVRWTLAPGDLAAYHKEEAGAQAWLSMLPPGPMTEGWFQCRQDPGGQVTSLYVPGPVTP
NPSSIVALWIGSLVLGLLALAFLAYRLWKRYRPGPRPDTSSCTLL
NT seq 1218 nt   +upstreamnt  +downstreamnt
atggagtctatcctggccctcctgctggccctggccctagtaccctaccagctcagtaga
gggcagtccttccaggtgaaccccccggaacctgaggtagctgtggccatgggcacatcc
ctccagatcacctgcagcatgtcctgtgacgagggtgtagcccgggtgcattggcgtggt
ctggacaccagcttgggcagtgtgcagaccctcccaggcagcagtatcctctctgtacgg
ggcatgctgtcagacacaggcactcctgtgtgcgtgggctcctgcgggagtcgaagcttc
cagcactccgtaaagatccttgtgtatgccttcccagaccagctggtggtgtccccggag
ttccttgtacctggacaggaccaggtggtgtcctgcacggcccacaacatctggcctgca
ggcccaaacagtctctcctttgccctgctgctgggagagcagagactggagggtgcccag
gccctggaaccagagcaagaggaggagatgcaagaggctgagggcacgccgttgttccga
atgacacaacgctggctgttaccctccctggggacccccgcccctcctgcccttcactgc
caggtcaccatgcagctgcccaaattggtgctgacccatagaagggaaattccagtgcta
cagagccagacctcacctaagccccacaacacaacctctgctgagccctacatcctgacc
tcatcaagtacagctgaggcagtctccactgcgctccacaccaccgccctgccttctgcc
cctccatactccaagctcagccctaggactctgagttctgagggaccttgccacccgaaa
atccaccaggacctggaggcaggctgggagctactctgtgaaacatcctgtgggcccgga
tttactgtgcgctggaccttggctcctggcgacctggcagcctaccacaaggaggaggcc
ggggcccaggcatggctaagcatgctgcccccaggtcccatgacagagggctggttccag
tgccgccaggaccctggcgggcaggtgaccagtctgtatgttcctggcccggtgacccca
aatccctcctccatcgtcgccctatggattggcagcttggtgctggggctgctcgcactg
gccttccttgcctaccgcctgtggaaacgctaccggccaggtccccgcccagacaccagc
tcatgtacactcctatag

DBGET integrated database retrieval system